Total number of results for FMRFamide related peptide are 867
Download
as Fasta All
NPID | Sequence | Length | Organism | Family | Name | PMID | Peptide_REF |
---|---|---|---|---|---|---|---|
NP01144 | FMRF |
4 | Achatina fulica | FMRFamide related peptide | FMRFamide | 8742492#Takeuchi H, Araki Y, Emaduddin M, Zhang W, Han XY, Salunga TL, Wong SM#Identifiable Achatina giant neurones: their localizations in ganglia, axonal pathways and pharmacological features#Gen Pharmacol 1996 Jan;27(1):3-32 Review | |
NP01145 | KNEFIRF |
7 | Achatina fulica | FMRFamide related peptide | Neuropeptide AF1 | 8745159#Araki Y, Liu GJ, Zhang W, Takeuchi H, Munekata E#Further mapping of the Achatina giant neurone types sensitive to the neuroactive peptides isolated from invertebrates#Gen Pharmacol 1995 Dec;26(8):1701-8 | |
NP01146 | FMRF |
4 | Aedes aegypti | FMRFamide related peptide | FMRFamide | 3738889#Brown MR, Crim JW, Lea AO#FMRFamide- and pancreatic polypeptide-like immunoreactivity of endocrine cells in the midgut of a mosquito#Tissue Cell 1986;18(3):419-28 | |
NP01147 | EGRF |
4 | Anthopleura elegantissima | FMRFamide related peptide | Antho-RFamide | 1429603#Schmutzler C, Darmer D, Diekhoff D, Grimmelikhuijzen CJ#Identification of a novel type of processing sites in the precursor for the sea anemone neuropeptide Antho-RFamide ( | |
NP01148 | QGRFG |
5 | Anthopleura elegantissima | FMRFamide related peptide | Antho-RFamide | 1429603#Schmutzler C, Darmer D, Diekhoff D, Grimmelikhuijzen CJ#Identification of a novel type of processing sites in the precursor for the sea anemone neuropeptide Antho-RFamide ( | |
NP01149 | FMRF |
4 | Aplysia kurodai | FMRFamide related peptide | FMRFamide | 3236575#Ichinose M, Sawada M, Maeno T#An acetylcholine-induced potassium current in tail sensory neurons in the pleural ganglion of Aplysia#Jpn J Physiol 1988;38(4):563-8 | |
NP01150 | SDPNFLRF |
8 | Ascaridia galli | FMRFamide related peptide | Neuropeptide PF1 | 15270251#Franks CJ, Walker RJ, Holden-Dye L#A structure-activity study of the neuropeptide PF1, SDPNFLRFamide, using the dorsal body wall muscle of the chicken nematode, Ascaridia galli#Acta Biol Hung 2004;55(1-4):343-51 | |
NP01151 | FDRDFMHF |
8 | Ascaris suum | FMRFamide related peptide | Neuropeptide AF17 | 11087928#Reinitz CA, Herfel HG, Messinger LA, Stretton AO#Changes in locomotory behavior and cAMP produced in Ascaris suum by neuropeptides from Ascaris suum or Caenorhabditis elegans#Mol Biochem Parasitol 2000 Nov;111(1):185-97 | |
NP01152 | SDPNFLRF |
8 | Ascaris suum | FMRFamide related peptide | Neuropeptide PF1 | 12633657#Thompson DP, Davis JP, Larsen MJ, Coscarelli EM, Zinser EW, Bowman JW, Alexander-Bowman SJ, Marks NJ, Geary TG#Effects of KHEYLRFamide and KNEFIRFamide on cyclic adenosine monophosphate levels in Ascaris suum somatic muscle#Int J Parasitol 2003 Feb;33(2):199-208 | |
NP01153 | SADPNFLRF |
9 | Ascaris suum | FMRFamide related peptide | Neuropeptide PF2 | 12613766#Willson J, Amliwala K, Harder A, Holden-Dye L, Walker RJ#The effect of the anthelmintic emodepside at the neuromuscular junction of the parasitic nematode Ascaris suum#Parasitology 2003 Jan;126(Pt 1):79-86 | |
NP01154 | KPNFIRF |
7 | Ascaris suum | FMRFamide related peptide | Neuropeptide PF4 | 9031739#Holden-Dye L, Brownlee DJ, Walker RJ#The effects of the peptide KPNFIRFamide (PF4) on the somatic muscle cells of the parasitic nematode Ascaris suum#Br J Pharmacol 1997 Feb;120(3):379-86 | |
NP01155 | GYIRF |
5 | Bdelloura candida | FMRFamide related peptide | GYIRFamide | 8951638#Johnston RN, Halton DW, Anderson PA, Johnston CF, Shaw C#The peptidergic nervous system of the triclad turbellarian, Bdelloura candida (Maricola, Bdellouridae): an immunocytochemical study using an antiserum raised to an endogenous neuropeptide, GYIRFamide#J Comp Neurol 1996 Dec 9;376(2):214-22 | |
NP01156 | FMRF |
4 | Branchiostoma lanceolatum | FMRFamide related peptide | FMRFamide | 10340145#Massari M, Candiani S, Pestarino M#Distribution and localization of immunoreactive FMRFamide-like peptides in the lancelet#Eur J Histochem 1999;43(1):63-9 | |
NP01157 | AGSDPNFLRFG |
11 | Caenorhabditis elegans | FMRFamide related peptide | FLP-1 | 1607945#Rosoff ML, Bürglin TR, Li C#Alternatively spliced transcripts of the flp-1 gene encode distinct FMRFamide-like peptides in Caenorhabditis elegans#J Neurosci 1992 Jun;12(6):2356-61 | |
NP01158 | FMRF |
4 | Caenorhabditis elegans | FMRFamide related peptide | FMRFamide | 15236235#Kim K, Li C#Expression and regulation of an FMRFamide-related neuropeptide gene family in Caenorhabditis elegans#J Comp Neurol 2004 Aug 2;475(4):540-50 | |
NP01159 | KNNKFEFIRF |
10 | Caenorhabditis elegans | FMRFamide related peptide | FMRFamide-like peptide | 19843350#Johnston MJ, McVeigh P, McMaster S, Fleming CC, Maule AG#FMRFamide-like peptides in root knot nematodes and their potential role in nematode physiology#J Helminthol 2010 Sep;84(3):253-65 | |
NP01160 | SADPNFLRFG |
10 | Caenorhabditis elegans | FMRFamide related peptide | FMRFamide-like peptide | 1607945#Rosoff ML, Bürglin TR, Li C#Alternatively spliced transcripts of the flp-1 gene encode distinct FMRFamide-like peptides in Caenorhabditis elegans#J Neurosci 1992 Jun;12(6):2356-61 | |
NP01161 | ADDGAPLIRF |
10 | Caenorhabditis elegans | FMRFamide related peptide | FMRFamide-related peptide | 11527423#Marks NJ, Shaw C, Halton DW, Thompson DP, Geary TG, Li C, Maule AG#Isolation and preliminary biological assessment of AADGAPLIRFamide and SVPGVLRFamide from Caenorhabditis elegans#Biochem Biophys Res Commun 2001 Sep 7;286(5):1170-6 | |
NP01162 | GFGDEMSMPGVLRF |
14 | Caenorhabditis elegans | FMRFamide related peptide | Neuropeptide AF10 | 11087928#Reinitz CA, Herfel HG, Messinger LA, Stretton AO#Changes in locomotory behavior and cAMP produced in Ascaris suum by neuropeptides from Ascaris suum or Caenorhabditis elegans#Mol Biochem Parasitol 2000 Nov;111(1):185-97 | |
NP01163 | FDRDFMHF |
8 | Caenorhabditis elegans | FMRFamide related peptide | Neuropeptide AF17 | 11087928#Reinitz CA, Herfel HG, Messinger LA, Stretton AO#Changes in locomotory behavior and cAMP produced in Ascaris suum by neuropeptides from Ascaris suum or Caenorhabditis elegans#Mol Biochem Parasitol 2000 Nov;111(1):185-97 | |
NP01164 | EGRF |
4 | Callinectes sapidus | FMRFamide related peptide | CP1/Antho-RFamide | 8462277#Yasuda A, Naya Y, Nakanishi K#Isolation of Antho-RFamide related peptides from the eyestalks of blue crab#Comp Biochem Physiol B 1993 Feb;104(2):235-40 | |
NP01165 | TNRNFLRF |
8 | Callinectes sapidus | FMRFamide related peptide | FMRFamide-like neuropeptide 4 | 17804580#Fort TJ, Brezina V, Miller MW#Regulation of the crab heartbeat by FMRFamide-like peptides: multiple interacting effects on center and periphery#J Neurophysiol 2007 Nov;98(5):2887-902 | |
NP01166 | FMRF |
4 | Calliphora vomitoria | FMRFamide related peptide | FMRFamide | 8118842#Duve H, Rehfeld JF, East P, Thorpe A#Localisation of sulfakinin neuronal pathways in the blowfly Calliphora vomitoria#Cell Tissue Res 1994 Jan;275(1):177-86 | |
NP01167 | KHKNYLRF |
8 | Cancer magister | FMRFamide related peptide | KHKNYLRFamide | 16515542#Cruz-Bermúdez ND, Fu Q, Kutz-Naber KK, Christie AE, Li L, Marder E#Mass spectrometric characterization and physiological actions of GAHKNYLRFamide, a novel FMRFamide-like peptide from crabs of the genus Cancer#J Neurochem 2006 May;97(3):784-99 | |
NP01168 | TNRNFLRF |
8 | Cancer productus | FMRFamide related peptide | FMRFamide-like neuropeptide 4 | 18719922#Verley DR, Doan V, Trieu Q, Messinger DI, Birmingham JT#Characteristic differences in modulation of stomatogastric musculature by a neuropeptide in three species of Cancer crabs#J Comp Physiol A Neuroethol Sens Neural Behav Physiol 2008 Oct;194(10):879-86 | |
NP01169 | EWLRGRF |
7 | Cyanea lamarckii | FMRFamide related peptide | Cyanea-RFamide I | 9245726#Moosler A, Rinehart KL, Grimmelikhuijzen CJ#Isolation of three novel neuropeptides, the Cyanea-RFamides I-III, from Scyphomedusae#Biochem Biophys Res Commun 1997 Jul 30;236(3):743-9 | |
NP01170 | EPLWSGRF |
8 | Cyanea lamarckii | FMRFamide related peptide | Cyanea-RFamide II | 9245726#Moosler A, Rinehart KL, Grimmelikhuijzen CJ#Isolation of three novel neuropeptides, the Cyanea-RFamides I-III, from Scyphomedusae#Biochem Biophys Res Commun 1997 Jul 30;236(3):743-9 | |
NP01171 | SKPANFIRF |
9 | Diploptera punctata | FMRFamide related peptide | FIRFamide | 14706529#Stay B, Zhang JR, Kwok RD, Tobe SS#Localization and physiological effects of RFamides in the corpora allata of the cockroach Diploptera punctata in relation to allatostatins#Peptides 2003 Oct;24(10):1501-10 | |
NP01172 | SDPFLRF |
7 | Doryteuthis pealeii | FMRFamide related peptide | SDPFLRFamide | 1362646#Cottrell GA, Lin JW, Llinas R, Price DA, Sugimori M, Stanley EF#FMRFamide-related peptides potentiate transmission at the squid giant synapse#Exp Physiol 1992 Nov;77(6):881-9 | |
NP01173 | DEGHKMLYF |
9 | Drosophila melanogaster | FMRFamide related peptide | FMRFamide-related peptide | 10818250#Johnson E, Ringo J, Dowse H#Native and heterologous neuropeptides are cardioactive in Drosophila melanogaster#J Insect Physiol 2000 Aug 1;46(8):1229-1236 | |
NP01174 | GYIRF |
5 | Dugesia tigrina | FMRFamide related peptide | GYIRFamide | 17362965#Omar HH, Humphries JE, Larsen MJ, Kubiak TM, Geary TG, Maule AG, Kimber MJ, Day TA#Identification of a platyhelminth neuropeptide receptor#Int J Parasitol 2007 Jun;37(7):725-33 | |
NP01175 | GYIRF |
5 | Eudiplozoon nipponicum | FMRFamide related peptide | GYIRFamide | 11403769#Zurawski TH, Mousley A, Mair GR, Brennan GP, Maule AG, Gelnar M, Halton DW#Immunomicroscopical observations on the nervous system of adult Eudiplozoon nipponicum (Monogenea: Diplozoidae)#Int J Parasitol 2001 Jun;31(8):783-92 | |
NP01176 | GNFFRF |
6 | Fasciola hepatica | FMRFamide related peptide | FMRFamide-related peptide | 9149416#Graham MK, Fairweather I, McGeown JG#The effects of FaRPs on the motility of isolated muscle strips from the liver fluke, Fasciola hepatica#Parasitology 1997 May;114 ( Pt 5):455-65 | |
NP01177 | GYIRF |
5 | Fasciola hepatica | FMRFamide related peptide | GYIRFamide | 11080073#Graham MK, Fairweather I, McGeown JG#Second messengers mediating mechanical responses to the FARP GYIRFamide in the fluke Fasciola hepatica#Am J Physiol Regul Integr Comp Physiol 2000 Dec;279(6):R2089-94 | |
NP01178 | KNEFIRF |
7 | Fasciola hepatica | FMRFamide related peptide | Neuropeptide AF1 | 9172424#Marks NJ, Maule AG, Halton DW, Geary TG, Shaw C, Thompson DP#Pharmacological effects of nematode FMRFamide-related peptides (FaRPs) on muscle contractility of the trematode, Fasciola hepatica#Parasitology 1997 Jun;114 ( Pt 6):531-9 | |
NP01179 | KHEYLRF |
7 | Fasciola hepatica | FMRFamide related peptide | Neuropeptide AF2 | 9172424#Marks NJ, Maule AG, Halton DW, Geary TG, Shaw C, Thompson DP#Pharmacological effects of nematode FMRFamide-related peptides (FaRPs) on muscle contractility of the trematode, Fasciola hepatica#Parasitology 1997 Jun;114 ( Pt 6):531-9 | |
NP01180 | KSAYMRF |
7 | Fasciola hepatica | FMRFamide related peptide | Neuropeptide AF8 | 9172424#Marks NJ, Maule AG, Halton DW, Geary TG, Shaw C, Thompson DP#Pharmacological effects of nematode FMRFamide-related peptides (FaRPs) on muscle contractility of the trematode, Fasciola hepatica#Parasitology 1997 Jun;114 ( Pt 6):531-9 | |
NP01181 | KNKFEFIRF |
9 | Globodera pallida | FMRFamide related peptide | FMRFamide-related peptide | 12117492#Kimber MJ, Fleming CC, Prior A, Jones JT, Halton DW, Maule AG#Localisation of Globodera pallida FMRFamide-related peptide encoding genes using in situ hybridisation#Int J Parasitol 2002 Aug;32(9):1095-105 | |
NP01182 | KHEYLRF |
7 | Globodera pallida | FMRFamide related peptide | Neuropeptide AF2 | 12117492#Kimber MJ, Fleming CC, Prior A, Jones JT, Halton DW, Maule AG#Localisation of Globodera pallida FMRFamide-related peptide encoding genes using in situ hybridisation#Int J Parasitol 2002 Aug;32(9):1095-105 | |
NP01183 | KSAYMRF |
7 | Globodera pallida | FMRFamide related peptide | Neuropeptide AF8 | 12117492#Kimber MJ, Fleming CC, Prior A, Jones JT, Halton DW, Maule AG#Localisation of Globodera pallida FMRFamide-related peptide encoding genes using in situ hybridisation#Int J Parasitol 2002 Aug;32(9):1095-105 | |
NP01184 | KPNQDFMRF |
9 | Haemonchus contortus | FMRFamide related peptide | CalliFMRFamide 4 | 15111097#Mousley A, Marks NJ, Halton DW, Geary TG, Thompson DP, Maule AG#Arthropod FMRFamide-related peptides modulate muscle activity in helminths#Int J Parasitol 2004 May;34(6):755-68 | |
NP01185 | KHEYLRF |
7 | Haemonchus contortus | FMRFamide related peptide | Neuropeptide AF2 | 11023415#Keating CD, Holden-Dye L, Thorndyke MC, Williams RG, Mallett A, Walker RJ#The FMRFamide-like neuropeptide AF2 is present in the parasitic nematode Haemonchus contortus#Parasitology 1995 Nov;111 ( Pt 4):515-21 | |
NP01186 | SDPDLDDVIRASLLAYSLDDSPNN |
24 | Haliotis asinina | FMRFamide related peptide | FMRFamide-related peptide | 21452226#Cummins SF, Tollenaere A, Degnan BM, Croll RP#Molecular analysis of two FMRFamide-encoding transcripts expressed during the development of the tropical abalone Haliotis asinina#J Comp Neurol 2011 Jul 1;519(10):2043-59 | |
NP01187 | SDPGEDMLKSILLRGAPSNNGLQY |
24 | Haliotis asinina | FMRFamide related peptide | FMRFamide-related peptide | 21452226#Cummins SF, Tollenaere A, Degnan BM, Croll RP#Molecular analysis of two FMRFamide-encoding transcripts expressed during the development of the tropical abalone Haliotis asinina#J Comp Neurol 2011 Jul 1;519(10):2043-59 | |
NP01188 | SVATAPVEAKAVEAGNKDIE |
20 | Haliotis asinina | FMRFamide related peptide | FMRFamide-related peptide | 21452226#Cummins SF, Tollenaere A, Degnan BM, Croll RP#Molecular analysis of two FMRFamide-encoding transcripts expressed during the development of the tropical abalone Haliotis asinina#J Comp Neurol 2011 Jul 1;519(10):2043-59 | |
NP01189 | FMRF |
4 | Hediste diversicolor | FMRFamide related peptide | FMRFamide | 2050144#Baratte B, Gras-Masse H, Ricart G, Bulet P, Dhainaut-Courtois N#Isolation and characterization of authentic Phe-Met-Arg-Phe-NH2 and the novel Phe-Thr-Arg-Phe-NH2 peptide from Nereis diversicolor#Eur J Biochem 1991 Jun 15;198(3):627-33 | |
NP01190 | FMRF |
4 | Helicoverpa zea | FMRFamide related peptide | FMRFamide | 9692236#Huang Y, Brown MR, Lee TD, Crim JW#RF-amide peptides isolated from the midgut of the corn earworm, Helicoverpa zea, resemble pancreatic polypeptide#Insect Biochem Mol Biol 1998 May-Jun;28(5-6):345-56 | |
NP01191 | FIRF |
4 | Helix aspersa | FMRFamide related peptide | FIRFamide | 3040968#Cottrell GA, Davies NW#Multiple receptor sites for a molluscan peptide (FMRFamide) and related peptides of Helix#J Physiol 1987 Jan;382:51-68 | |
NP01192 | DNFLRF |
6 | Helix aspersa | FMRFamide related peptide | FxRFamide related neuropeptide | 10574439#Pedder SM, Walker RJ#The actions of FxRFamide related neuropeptides on identified neurones from the snail, Helix aspersa#Acta Biol Hung 1999;50(1-3):185-98 | |
NP01193 | PDVDHVFLRF |
10 | Helix aspersa | FMRFamide related peptide | FxRFamide related neuropeptide | 10574439#Pedder SM, Walker RJ#The actions of FxRFamide related neuropeptides on identified neurones from the snail, Helix aspersa#Acta Biol Hung 1999;50(1-3):185-98 | |
NP01194 | KNEFIRF |
7 | Helix aspersa | FMRFamide related peptide | Neuropeptide AF1 | 10574439#Pedder SM, Walker RJ#The actions of FxRFamide related neuropeptides on identified neurones from the snail, Helix aspersa#Acta Biol Hung 1999;50(1-3):185-98 | |
NP01195 | SDPNFLRF |
8 | Helix aspersa | FMRFamide related peptide | Neuropeptide PF1 | 10574439#Pedder SM, Walker RJ#The actions of FxRFamide related neuropeptides on identified neurones from the snail, Helix aspersa#Acta Biol Hung 1999;50(1-3):185-98 | |
NP01196 | EDPFLRF |
7 | Helix aspersa | FMRFamide related peptide | pQDPFLRFamide | 3040968#Cottrell GA, Davies NW#Multiple receptor sites for a molluscan peptide (FMRFamide) and related peptides of Helix#J Physiol 1987 Jan;382:51-68 | |
NP01197 | SKPYMRF |
7 | Helix aspersa | FMRFamide related peptide | SKPYMRFamide | 7789722#Pivovarov AS, Sharma R, Walker RJ#Inhibitory action of SKPYMRFamide on acetylcholine receptors of Helix aspersa neurons: role of second messengers#Gen Pharmacol 1995 May;26(3):495-505 | |
NP01198 | SEPYLRF |
7 | Helix lucorum | FMRFamide related peptide | SEPYLRFamide | 17049630#Pivovarov AS, Foreman RC, Walker RJ#Involvement of Na,K-pump in SEPYLRFamide-mediated reduction of cholinosensitivity in Helix neurons#Regul Pept 2007 Feb 1;138(2-3):103-12 | |
NP01199 | FMRF |
4 | Helix pomatia | FMRFamide related peptide | FMRFamide | 3382722#Shevëlkin AV, Nikitin VP#[Effects of FMRFamide on the activity of command neurons in defensive behavior of fed and fasting snails, Helix pomatia]#Biull Eksp Biol Med 1988 May;105(5):517-20 Russian | |
NP01200 | FLRF |
4 | Heterodera glycines | FMRFamide related peptide | FLRFamide | 18005465#Masler EP#Responses of Heterodera glycines and Meloidogyne incognita to exogenously applied neuromodulators#J Helminthol 2007 Dec;81(4):421-7 | |
NP01201 | FMRF |
4 | Hexagrammos stelleri | FMRFamide related peptide | FMRFamide | 2312792#Uchiyama H#Immunohistochemical subpopulations of retinopetal neurons in the nucleus olfactoretinalis in a teleost, the whitespotted greenling (Hexagrammos stelleri)#J Comp Neurol 1990 Mar 1;293(1):54-62 | |
NP01202 | QDPFLRF |
7 | Hirudo medicinalis | FMRFamide related peptide | QDPFLRF-amide | 12491073#O'Gara BA, Brown PL, Dlugosch D, Kandiel A, Ku JW, Geier JK, Henggeler NC, Abbasi A, Kounalakis N#Regulation of pharyngeal motility by FMRFamide and related peptides in the medicinal leech, Hirudo medicinalis#Invert Neurosci 1999-2000;4(1):41-53 | |
NP01203 | EWLGGRF |
7 | Hydra vulgaris | FMRFamide related peptide | Hydra-RFamide I | 8954943#Moosler A, Rinehart KL, Grimmelikhuijzen CJ#Isolation of four novel neuropeptides, the hydra-RFamides I-IV, from Hydra magnipapillata#Biochem Biophys Res Commun 1996 Dec 13;229(2):596-602 | |
NP01204 | EWFNGRF |
7 | Hydra vulgaris | FMRFamide related peptide | Hydra-RFamide II | 8954943#Moosler A, Rinehart KL, Grimmelikhuijzen CJ#Isolation of four novel neuropeptides, the hydra-RFamides I-IV, from Hydra magnipapillata#Biochem Biophys Res Commun 1996 Dec 13;229(2):596-602 | |
NP01205 | KPHLRGRF |
8 | Hydra vulgaris | FMRFamide related peptide | Hydra-RFamide III | 8954943#Moosler A, Rinehart KL, Grimmelikhuijzen CJ#Isolation of four novel neuropeptides, the hydra-RFamides I-IV, from Hydra magnipapillata#Biochem Biophys Res Commun 1996 Dec 13;229(2):596-602 | |
NP01206 | HLRGRF |
6 | Hydra vulgaris | FMRFamide related peptide | Hydra-RFamide IV | 8954943#Moosler A, Rinehart KL, Grimmelikhuijzen CJ#Isolation of four novel neuropeptides, the hydra-RFamides I-IV, from Hydra magnipapillata#Biochem Biophys Res Commun 1996 Dec 13;229(2):596-602 | |
NP01207 | FLRF |
4 | Idiosepius notoides | FMRFamide related peptide | FLRFamide | 20433453#Wollesen T, Cummins SF, Degnan BM, Wanninger A#FMRFamide gene and peptide expression during central nervous system development of the cephalopod mollusk, Idiosepius notoides#Evol Dev 2010 Mar-Apr;12(2):113-30 | |
NP01208 | FMRF |
4 | Lampetra japonica | FMRFamide related peptide | FMRFamide | 2743395#Ohtomi M, Fujii K, Kobayashi H#Distribution of FMRFamide-like immunoreactivity in the brain and neurohypophysis of the lamprey, Lampetra japonica#Cell Tissue Res 1989 Jun;256(3):581-4 | |
NP01209 | SIPNLPQRF |
9 | Lithobates catesbeiana | FMRFamide related peptide | fGRP-related peptide 1 | 12600686#Kanetoh T, Sugikawa T, Sasaki I, Muneoka Y, Minakata H, Takabatake I, Fujimoto M#Identification of a novel frog RFamide and its effect on the latency of the tail-flick response of the newt#Comp Biochem Physiol C Toxicol Pharmacol 2003 Feb;134(2):259-66 | |
NP01210 | ADVGHVFLRF |
10 | Locusta migratoria | FMRFamide related peptide | FMRFamide-related peptide | 11897379#Clark J, Lange AB#Evidence for the association of FMRFamide-related peptides with the spermatheca of Locusta migratoria#Peptides 2002 Apr;23(4):613-9 | |
NP01211 | GQERNFLRF |
9 | Locusta migratoria | FMRFamide related peptide | FMRFamide-related peptide | 11897379#Clark J, Lange AB#Evidence for the association of FMRFamide-related peptides with the spermatheca of Locusta migratoria#Peptides 2002 Apr;23(4):613-9 | |
NP01212 | LWENLRF |
7 | Locusta migratoria | FMRFamide related peptide | RFamide | 17707763#Hill SR, Orchard I#Isolation and sequencing of two FMRFamide-related peptides from the gut of Locusta migratoria L#Peptides 2007 Aug;28(8):1490-7 | |
NP01213 | FMRF |
4 | Loligo forbesi | FMRFamide related peptide | FMRFamide | 10835048#Chrachri A, Odblom M, Williamson R#G protein-mediated FMRFamidergic modulation of calcium influx in dissociated heart muscle cells from squid, Loligo forbesii#J Physiol 2000 Jun 1;525 Pt 2:471-82 | |
NP01214 | TPHWRPQGRF |
10 | Lymnaea stagnalis | FMRFamide related peptide | RFamide | 9822740#Tensen CP, Cox KJ, Smit AB, van der Schors RC, Meyerhof W, Richter D, Planta RJ, Hermann PM, van Minnen J, Geraerts WP, Knol JC, Burke JF, Vreugdenhil E, van Heerikhuizen H#The lymnaea cardioexcitatory peptide (LyCEP) receptor: a G-protein-coupled receptor for a novel member of the RFamide neuropeptide family#J Neurosci 1998 Dec 1;18(23):9812-21 | |
NP01215 | SDPYLFR |
7 | Lymnaea stagnalis | FMRFamide related peptide | SDPYLFRamide | 2002360#Saunders SE, Bright K, Kellett E, Benjamin PR, Burke JF#Neuropeptides Gly-Asp-Pro-Phe-Leu-Arg-Phe-amide (GDPFLRFamide) and Ser-Asp-Pro-Phe-Leu-Arg-Phe-amide (SDPFLRFamide) are encoded by an exon 3' to Phe-Met-Arg-Phe-NH2 (FMRFamide) in the snail Lymnaea stagnalis#J Neurosci 1991 Mar;11(3):740-5 | |
NP01216 | SGRNMEVSLVRQVLNLPQRF |
20 | Macaca mulatta | FMRFamide related peptide | Gonadotropin-inhibitory hormone | 19844991#Ubuka T, Lai H, Kitani M, Suzuuchi A, Pham V, Cadigan PA, Wang A, Chowdhury VS, Tsutsui K, Bentley GE#Gonadotropin-inhibitory hormone identification, cDNA cloning, and distribution in rhesus macaque brain#J Comp Neurol 2009 Dec 20;517(6):841-55 | |
NP01217 | GYRKPPFNGSIF |
12 | Macrobrachium rosenbergii | FMRFamide related peptide | SIFamide | 20040755#Vázquez-Acevedo N, Rivera NM, Torres-González AM, Rullan-Matheu Y, Ruíz-Rodríguez EA, Sosa MA#GYRKPPFNGSIFamide (Gly-SIFamide) modulates aggression in the freshwater prawn Macrobrachium rosenbergii#Biol Bull 2009 Dec;217(3):313-26 | |
NP01218 | FLRF |
4 | Manduca sexta | FMRFamide related peptide | FLRFamide | 9828051#Miao Y, Waters EM, Witten JL#Developmental and regional-specific expression of FLRFamide peptides in the tobacco hornworm, Manduca sexta, suggests functions at ecdysis#J Neurobiol 1998 Nov 15;37(3):469-85 | |
NP01219 | YAEAAGEQVPEYQALVRDYPQLLDSGMKRQDVVHSFLRF |
39 | Manduca sexta | FMRFamide related peptide | FLRFamide | 9359469#Kingan TG, Zitnan D, Jaffe H, Beckage NE#Identification of neuropeptides in the midgut of parasitized insects: FLRFamides as candidate paracrines#Mol Cell Endocrinol 1997 Sep 30;133(1):19-32 | |
NP01220 | FMRF |
4 | Manduca sexta | FMRFamide related peptide | FMRFamide | 2909410#Copenhaver PF, Taghert PH#Development of the enteric nervous system in the moth#I Diversity of cell types and the embryonic expression of FMRFamide-related neuropeptides Dev Biol 1989 Jan;131(1):70-84 | |
NP01221 | APLDRSALVRF |
11 | Meloidogyne incognita | FMRFamide related peptide | APLDRSALVRFamide | 19843350#Johnston MJ, McVeigh P, McMaster S, Fleming CC, Maule AG#FMRFamide-like peptides in root knot nematodes and their potential role in nematode physiology#J Helminthol 2010 Sep;84(3):253-65 | |
NP01222 | FLRF |
4 | Meloidogyne incognita | FMRFamide related peptide | FLRFamide | 18005465#Masler EP#Responses of Heterodera glycines and Meloidogyne incognita to exogenously applied neuromodulators#J Helminthol 2007 Dec;81(4):421-7 | |
NP01223 | TNRNFLRF |
8 | Metacarcinus magister | FMRFamide related peptide | FMRFamide-like neuropeptide 4 | 18719922#Verley DR, Doan V, Trieu Q, Messinger DI, Birmingham JT#Characteristic differences in modulation of stomatogastric musculature by a neuropeptide in three species of Cancer crabs#J Comp Physiol A Neuroethol Sens Neural Behav Physiol 2008 Oct;194(10):879-86 | |
NP01224 | AGEGLSSPFWSLAPQRF |
17 | Mus musculus | FMRFamide related peptide | Neuropeptide AF | 2067975#Kavaliers M, Yang HY#Effects of mammalian FMRF-NH2-related peptides and IgG from antiserum against them on aggression and defeat-induced analgesia in mice#Peptides 1991 Mar-Apr;12(2):235-9 | |
NP01225 | FLQPQRF |
7 | Mus musculus | FMRFamide related peptide | Neuropeptide FF | 8233035#Kavaliers M, Colwell DD#Neuropeptide FF (FLQPQRFamide) and IgG from neuropeptide FF antiserum affect spatial learning in mice#Neurosci Lett 1993 Jul 9;157(1):75-8 | |
NP01226 | SLAAPQRF |
8 | Mus musculus | FMRFamide related peptide | Neuropeptide SF | 22580381#Kotlinska JH, Gibula-Bruzda E, Suder P, Wasielak M, Bray L, Raoof H, Bodzon-Kulakowska A, Silberring J#Crypteins derived from the mouse neuropeptide FF (NPFF)A precursor display NPFF-like effects in nociceptive tests in mice#Peptides 2012 Jul;36(1):17-22 | |
NP01227 | EPYLRF |
6 | NA | FMRFamide related peptide | EPYLRFamide | 12609746#Pivovarov AS, Walker RJ#EPYLRFamide-mediated reduction of acetylcholine-induced inward currents in Helix lucorum-identified neurones: role of NAADP-dependent and IP3-dependent Ca2+ release from internal stores, calmodulin and Ca2+/calmodulin-dependent protein kinase II#Regul Pept 2003 Mar 28;111(1-3):31-9 | |
NP01228 | FMLF |
4 | NA | FMRFamide related peptide | FMRFamide | 9622030#Heyliger SO, Payza K, Rothman RB#The effect of FMRFamide analogs on [35S]GTP-gamma-S stimulation in squid optic lobes#Peptides 1998;19(4):739-47 | |
NP01229 | XDYGHMRF |
8 | NA | FMRFamide related peptide | FMRFamide-related peptide | 12747944#Duttlinger A, Mispelon M, Nichols R#The structure of the FMRFamide receptor and activity of the cardioexcitatory neuropeptide are conserved in mosquito#Neuropeptides 2003 Apr;37(2):120-6 | |
NP01230 | SIKPSAYLPLRF |
12 | NA | FMRFamide related peptide | Gonadotropin-inhibitory hormone | 17901228#Ubuka T, Kim S, Huang YC, Reid J, Jiang J, Osugi T, Chowdhury VS, Tsutsui K, Bentley GE#Gonadotropin-inhibitory hormone neurons interact directly with gonadotropin-releasing hormone-I and -II neurons in European starling brain#Endocrinology 2008 Jan;149(1):268-78 | |
NP01231 | SWGAPAEKFWMRAMPQRF |
18 | NA | FMRFamide related peptide | RFamide | 16623709#Osugi T, Ukena K, Sower SA, Kawauchi H, Tsutsui K#Evolutionary origin and divergence of PQRFamide peptides and LPXRFamide peptides in the RFamide peptide family#Insights from novel lamprey RFamide peptides FEBS J 2006 Apr;273(8):1731-43 | |
NP01232 | YGGFMKKKFMRF |
12 | NA | FMRFamide related peptide | YFamde | 19560378#Vats ID, Snehlata, Nath M, Pasha MA, Pasha S#Effect of chronic intra-peritoneally administered chimeric peptide of met-enkephalin and FMRFa-[D-Ala2]YFa-on antinociception and opioid receptor regulation#Eur J Pain 2010 Mar;14(3):295e1-9 | |
NP01233 | ANRSLRLRF |
9 | Periplaneta americana | FMRFamide related peptide | RFamide | 7646507#Veenstra JA, Lambrou G#Isolation of a novel RFamide peptide from the midgut of the American cockroach, Periplaneta americana#Biochem Biophys Res Commun 1995 Aug 15;213(2):519-24 | |
NP01234 | MPPKPDNPSPDASPELSKYMLAVRNYINLITRQRY |
35 | Petromyzon marinus | FMRFamide related peptide | Peptide methionine-tyrosine | 2070789#Conlon JM, Bjørnholm B, Jørgensen FS, Youson JH, Schwartz TW#Primary structure and conformational analysis of peptide methionine-tyrosine, a peptide related to neuropeptide Y and peptide YY isolated from lamprey intestine#Eur J Biochem 1991 Jul 15;199(2):293-8 | |
NP01235 | FMRF |
4 | Polyorchis penicillatus | FMRFamide related peptide | FMRFamide | 6151569#Grimmelikhuijzen CJ, Spencer AN#FMRFamide immunoreactivity in the nervous system of the medusa Polyorchis penicillatus#J Comp Neurol 1984 Dec 10;230(3):361-71 | |
NP01236 | ELLGGRF |
7 | Polyorchis penicillatus | FMRFamide related peptide | Pol-RFamide I | 7909659#Schmutzler C, Diekhoff D, Grimmelikhuijzen CJ#The primary structure of the Pol-RFamide neuropeptide precursor protein from the hydromedusa Polyorchis penicillatus indicates a novel processing proteinase activity#Biochem J 1994 Apr 15;299 ( Pt 2):431-6 | |
NP01237 | EWLKGRF |
7 | Polyorchis penicillatus | FMRFamide related peptide | Pol-RFamide II | 7909659#Schmutzler C, Diekhoff D, Grimmelikhuijzen CJ#The primary structure of the Pol-RFamide neuropeptide precursor protein from the hydromedusa Polyorchis penicillatus indicates a novel processing proteinase activity#Biochem J 1994 Apr 15;299 ( Pt 2):431-6 | |
NP01238 | EGRF |
4 | Polyorchis penicillatus | FMRFamide related peptide | RFamide | 2905621#Grimmelikhuijzen CJ, Hahn M, Rinehart KL, Spencer AN#Isolation of pyroGlu-Leu-Leu-Gly-Gly-Arg-Phe-NH2 (Pol-RFamide), a novel neuropeptide from hydromedusae#Brain Res 1988 Dec 13;475(1):198-203 | |
NP01239 | GYRKPPFNGSIFG |
13 | Procambarus clarkii | FMRFamide related peptide | SIFamide | 14723891#Yasuda A, Yasuda-Kamatani Y, Nozaki M, Nakajima T#Identification of GYRKPPFNGSIFamide (crustacean-SIFamide) in the crayfish Procambarus clarkii by topological mass spectrometry analysis#Gen Comp Endocrinol 2004 Feb;135(3):391-400 | |
NP01240 | AGEGLSSPFWSLAAPQR |
17 | Rattus norvegicus | FMRFamide related peptide | Neuropeptide AF | 17980934#Dylag T, Pachuta A, Raoof H, Kotlinska J, Silberring J#A novel cryptic peptide derived from the rat neuropeptide FF precursor reverses antinociception and conditioned place preference induced by morphine#Peptides 2008 Mar;29(3):473-8 | |
NP01241 | YFMRF |
5 | Rattus norvegicus | FMRFamide related peptide | Tyr-FMRFamide | 7937312#Raffa RB, Kim A, Rice KC, de Costa BR, Codd EE, Rothman RB#Low affinity of FMRFamide and four FaRPs (FMRFamide-related peptides), including the mammalian-derived FaRPs F-8-Famide (NPFF) and A-18-Famide, for opioid mu, delta, kappa 1, kappa 2a, or kappa 2b receptors#Peptides 1994;15(3):401-4 | |
NP01242 | EGRF |
4 | Renilla koellikeri | FMRFamide related peptide | Antho-RFamide | 7906718#Reinscheid RK, Grimmelikhuijzen CJ#Primary structure of the precursor for the anthozoan neuropeptide antho-RFamide from Renilla köllikeri: evidence for unusual processing enzymes#J Neurochem 1994 Mar;62(3):1214-22 | |
NP01243 | QGRFG |
5 | Renilla koellikeri | FMRFamide related peptide | Antho-RFamide | 7906718#Reinscheid RK, Grimmelikhuijzen CJ#Primary structure of the precursor for the anthozoan neuropeptide antho-RFamide from Renilla köllikeri: evidence for unusual processing enzymes#J Neurochem 1994 Mar;62(3):1214-22 | |
NP01244 | DRSDNFIRF |
9 | Rhyparobia maderae | FMRFamide related peptide | Pea-FMRFa-7 | 18338182#Soehler S, Neupert S, Predel R, Stengl M#Examination of the role of FMRFamide-related peptides in the circadian clock of the cockroach Leucophaea maderae#Cell Tissue Res 2008 May;332(2):257-69 | |
NP01245 | FMRF |
4 | Salmo salar | FMRFamide related peptide | FMRFamide | 1486597#Vecino E, Ekström P#Colocalization of neuropeptide Y (NPY)-like and FMRFamide-like immunoreactivities in the brain of the Atlantic salmon (Salmo salar)#Cell Tissue Res 1992 Dec;270(3):435-42 | |
NP01246 | YIRF |
4 | Schistosoma mansoni | FMRFamide related peptide | FMRFamide-like peptide | 20706630#Novozhilova E, Kimber MJ, Qian H, McVeigh P, Robertson AP, Zamanian M, Maule AG, Day TA#FMRFamide-like peptides (FLPs) enhance voltage-gated calcium currents to elicit muscle contraction in the human parasite Schistosoma mansoni#PLoS Negl Trop Dis 2010 Aug 10;4(8):e790 | |
NP01247 | GYIRF |
5 | Schistosoma mansoni | FMRFamide related peptide | GYIRFamide | 11085236#Mair GR, Maule AG, Day TA, Halton DW#A confocal microscopical study of the musculature of adult Schistosoma mansoni#Parasitology 2000 Aug;121 ( Pt 2):163-70 | |
NP01248 | FMRF |
4 | Scyliorhinus torazame | FMRFamide related peptide | FMRFamide | 1682050#Chiba A, Oka S, Honma Y#Immunocytochemical distribution of FMRFamide-like substance in the brain of the cloudy dogfish, Scyliorhinus torazame#Cell Tissue Res 1991 Aug;265(2):243-50 | |
NP01249 | LPLRF |
5 | Sphyrna tiburo tiburo | FMRFamide related peptide | LPLRFamide | 7706549#White J, Meredith M#Nervus terminalis ganglion of the bonnethead shark (Sphyrna tiburo): evidence for cholinergic and catecholaminergic influence on two cell types distinguished by peptide immunocytochemistry#J Comp Neurol 1995 Jan 16;351(3):385-403 | |
NP01250 | GYRKPPFNGSIFG |
13 | Aedes aegypti | FMRFamide related peptide | ext SIFa | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
NP01251 | SALDKNFMRF |
10 | Aedes aegypti | FMRFamide related peptide | FMRFa-1 | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
NP01252 | SDPRFLRLV |
9 | Aedes aegypti | FMRFamide related peptide | FMRFa-10 | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
NP01253 | MDNNFMRF |
8 | Aedes aegypti | FMRFamide related peptide | FMRFa-11 | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
NP01254 | DSPKNLMRF |
9 | Aedes aegypti | FMRFamide related peptide | FMRFa-4 | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
NP01255 | ANLMRF |
6 | Aedes aegypti | FMRFamide related peptide | FMRFa-6 | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
NP01256 | GSGNLMRF |
8 | Aedes aegypti | FMRFamide related peptide | FMRFa-8 | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
NP01257 | ASKQANLMRF |
10 | Aedes aegypti | FMRFamide related peptide | FMRFamide-2 | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
NP01258 | AGQGFMRF |
8 | Aedes aegypti | FMRFamide related peptide | FMRFamide-3 | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
NP01259 | DDTNKFLRLS |
10 | Aedes aegypti | FMRFamide related peptide | FMRFamide-5 | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
NP01260 | AGSEAGGNLQRTNFLRF |
17 | Aedes aegypti | FMRFamide related peptide | FMRFamide-7 | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
NP01261 | AKGNLMRF |
8 | Aedes aegypti | FMRFamide related peptide | FMRFamide-9 | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
NP01262 | GYRKPPFNGSIF |
12 | Aedes aegypti | FMRFamide related peptide | SIFamide | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
NP01263 | AYRKPPFNGSIF |
12 | Apis mellifera | FMRFamide related peptide | SIFamide | 19576913#Boerjan B, Cardoen D, Bogaerts A, Landuyt B, Schoofs L, Verleyen P#Mass spectrometric profiling of (neuro)-peptides in the worker honeybee, Apis mellifera#Neuropharmacology 2010 Jan;58(1):248-58 | |
NP01264 | RKPPFNGSIF |
10 | Apis mellifera | FMRFamide related peptide | SIFamide | 19576913#Boerjan B, Cardoen D, Bogaerts A, Landuyt B, Schoofs L, Verleyen P#Mass spectrometric profiling of (neuro)-peptides in the worker honeybee, Apis mellifera#Neuropharmacology 2010 Jan;58(1):248-58 | |
NP01265 | YRKPPFNGSIF |
11 | Apis mellifera | FMRFamide related peptide | SIFamide | 19576913#Boerjan B, Cardoen D, Bogaerts A, Landuyt B, Schoofs L, Verleyen P#Mass spectrometric profiling of (neuro)-peptides in the worker honeybee, Apis mellifera#Neuropharmacology 2010 Jan;58(1):248-58 | |
NP01266 | AGFKNLNREQ |
10 | Apis mellifera | FMRFamide related peptide | TWKSPDIVIRFa–FMRFa-like | 19576913#Boerjan B, Cardoen D, Bogaerts A, Landuyt B, Schoofs L, Verleyen P#Mass spectrometric profiling of (neuro)-peptides in the worker honeybee, Apis mellifera#Neuropharmacology 2010 Jan;58(1):248-58 | |
NP01267 | SVLTTLKTDGGLRIFKDAPNEF |
22 | Apis mellifera | FMRFamide related peptide | TWKSPDIVIRFa–FMRFa-like | 19576913#Boerjan B, Cardoen D, Bogaerts A, Landuyt B, Schoofs L, Verleyen P#Mass spectrometric profiling of (neuro)-peptides in the worker honeybee, Apis mellifera#Neuropharmacology 2010 Jan;58(1):248-58 | |
NP01268 | TWKSPDIVIRF |
11 | Apis mellifera | FMRFamide related peptide | TWKSPDIVIRFa–FMRFa-like | 19576913#Boerjan B, Cardoen D, Bogaerts A, Landuyt B, Schoofs L, Verleyen P#Mass spectrometric profiling of (neuro)-peptides in the worker honeybee, Apis mellifera#Neuropharmacology 2010 Jan;58(1):248-58 | |
NP01269 | GGALFRF |
7 | Aplysia | FMRFamide related peptide | Aplysia FRF-A | 15715658#Hoek RM, Li KW, van Minnen J, Lodder JC, de Jong-Brink M, Smit AB, van Kesteren RE#LFRFamides: a novel family of parasitation-induced -RFamide neuropeptides that inhibit the activity of neuroendocrine cells in Lymnaea stagnalis#J Neurochem 2005 Mar;92(5):1073-80 | |
NP01270 | STLFRF |
6 | Aplysia | FMRFamide related peptide | Aplysia FRF-C | 15715658#Hoek RM, Li KW, van Minnen J, Lodder JC, de Jong-Brink M, Smit AB, van Kesteren RE#LFRFamides: a novel family of parasitation-induced -RFamide neuropeptides that inhibit the activity of neuroendocrine cells in Lymnaea stagnalis#J Neurochem 2005 Mar;92(5):1073-80 | |
NP01271 | DFDRDFMHF |
9 | Ascaris suum | FMRFamide related peptide | Neuropeptide AF17+O | 21524146#Jarecki JL, Frey BL, Smith LM, Stretton AO#Discovery of neuropeptides in the nematode Ascaris suum by database mining and tandem mass spectrometry#J Proteome Res 2011 Jul 1;10(7):3098-106 | |
NP01272 | AEGLSSPLIRF |
11 | Ascaris suum | FMRFamide related peptide | Neuropeptide AF19 | 21524146#Jarecki JL, Frey BL, Smith LM, Stretton AO#Discovery of neuropeptides in the nematode Ascaris suum by database mining and tandem mass spectrometry#J Proteome Res 2011 Jul 1;10(7):3098-106 | |
NP01273 | PADPNFLRF |
9 | Ascaris suum | FMRFamide related peptide | Neuropeptide AF27 | 21524146#Jarecki JL, Frey BL, Smith LM, Stretton AO#Discovery of neuropeptides in the nematode Ascaris suum by database mining and tandem mass spectrometry#J Proteome Res 2011 Jul 1;10(7):3098-106 | |
NP01274 | SAEPNFLRF |
9 | Ascaris suum | FMRFamide related peptide | Neuropeptide AF28 | 21524146#Jarecki JL, Frey BL, Smith LM, Stretton AO#Discovery of neuropeptides in the nematode Ascaris suum by database mining and tandem mass spectrometry#J Proteome Res 2011 Jul 1;10(7):3098-106 | |
NP01275 | NAEPNFLRF |
9 | Ascaris suum | FMRFamide related peptide | Neuropeptide AF29 | 21524146#Jarecki JL, Frey BL, Smith LM, Stretton AO#Discovery of neuropeptides in the nematode Ascaris suum by database mining and tandem mass spectrometry#J Proteome Res 2011 Jul 1;10(7):3098-106 | |
NP01276 | ENEKKAVPGVLRF |
13 | Ascaris suum | FMRFamide related peptide | Neuropeptide AF3 | 21524146#Jarecki JL, Frey BL, Smith LM, Stretton AO#Discovery of neuropeptides in the nematode Ascaris suum by database mining and tandem mass spectrometry#J Proteome Res 2011 Jul 1;10(7):3098-106 | |
NP01277 | GSDPNFLRF |
9 | Ascaris suum | FMRFamide related peptide | Neuropeptide AF32 | 21524146#Jarecki JL, Frey BL, Smith LM, Stretton AO#Discovery of neuropeptides in the nematode Ascaris suum by database mining and tandem mass spectrometry#J Proteome Res 2011 Jul 1;10(7):3098-106 | |
NP01278 | DSKLMDPLIRF |
11 | Ascaris suum | FMRFamide related peptide | Neuropeptide AF34+O | 21524146#Jarecki JL, Frey BL, Smith LM, Stretton AO#Discovery of neuropeptides in the nematode Ascaris suum by database mining and tandem mass spectrometry#J Proteome Res 2011 Jul 1;10(7):3098-106 | |
NP01279 | DPQQRIVTDETVLRF |
15 | Ascaris suum | FMRFamide related peptide | Neuropeptide AF35 | 20806053#Jarecki JL, Andersen K, Konop CJ, Knickelbine JJ, Vestling MM, Stretton AO#Mapping neuropeptide expression by mass spectrometry in single dissected identified neurons from the dorsal ganglion of the nematode Ascaris suum#ACS Chem Neurosci 2010 Jul 21;1(7):505-519 | |
NP01280 | VPSAADMMIRF |
11 | Ascaris suum | FMRFamide related peptide | Neuropeptide AF36+O2 | 21524146#Jarecki JL, Frey BL, Smith LM, Stretton AO#Discovery of neuropeptides in the nematode Ascaris suum by database mining and tandem mass spectrometry#J Proteome Res 2011 Jul 1;10(7):3098-106 | |
NP01281 | AQREPIRF |
8 | Ascaris suum | FMRFamide related peptide | Neuropeptide AF38 | 20806053#Jarecki JL, Andersen K, Konop CJ, Knickelbine JJ, Vestling MM, Stretton AO#Mapping neuropeptide expression by mass spectrometry in single dissected identified neurons from the dorsal ganglion of the nematode Ascaris suum#ACS Chem Neurosci 2010 Jul 21;1(7):505-519 | |
NP01282 | GNSYRSFFNPNEYTVVE |
17 | Ascaris suum | FMRFamide related peptide | PepGE | 20806053#Jarecki JL, Andersen K, Konop CJ, Knickelbine JJ, Vestling MM, Stretton AO#Mapping neuropeptide expression by mass spectrometry in single dissected identified neurons from the dorsal ganglion of the nematode Ascaris suum#ACS Chem Neurosci 2010 Jul 21;1(7):505-519 | |
NP01283 | SGRVDHIHDILSTLQRLQLANE |
22 | Ascaris suum | FMRFamide related peptide | PepSE | 21524146#Jarecki JL, Frey BL, Smith LM, Stretton AO#Discovery of neuropeptides in the nematode Ascaris suum by database mining and tandem mass spectrometry#J Proteome Res 2011 Jul 1;10(7):3098-106 | |
NP01284 | TPPEEDLLGRFT |
12 | Ascaris suum | FMRFamide related peptide | PepTT | 21524146#Jarecki JL, Frey BL, Smith LM, Stretton AO#Discovery of neuropeptides in the nematode Ascaris suum by database mining and tandem mass spectrometry#J Proteome Res 2011 Jul 1;10(7):3098-106 | |
NP01285 | TNIMGENRLNRNL |
13 | Ascaris suum | FMRFamide related peptide | PeptTL+ O | 21524146#Jarecki JL, Frey BL, Smith LM, Stretton AO#Discovery of neuropeptides in the nematode Ascaris suum by database mining and tandem mass spectrometry#J Proteome Res 2011 Jul 1;10(7):3098-106 | |
NP01286 | AAADPNFLRF |
10 | Caenorhabditis briggsae | FMRFamide related peptide | FLP-1 | 18760316#Husson SJ, Landuyt B, Nys T, Baggerman G, Boonen K, Clynen E, Lindemans M, Janssen T, Schoofs L#Comparative peptidomics of Caenorhabditis elegans versus C#briggsae by LC-MALDI-TOF MS Peptides 2009 Mar;30(3):449-57 | |
NP01287 | AGSDPNFLRF |
10 | Caenorhabditis briggsae | FMRFamide related peptide | FLP-1 | 18760316#Husson SJ, Landuyt B, Nys T, Baggerman G, Boonen K, Clynen E, Lindemans M, Janssen T, Schoofs L#Comparative peptidomics of Caenorhabditis elegans versus C#briggsae by LC-MALDI-TOF MS Peptides 2009 Mar;30(3):449-57 | |
NP01288 | SQPNFLRF |
8 | Caenorhabditis briggsae | FMRFamide related peptide | FLP-1 | 18760316#Husson SJ, Landuyt B, Nys T, Baggerman G, Boonen K, Clynen E, Lindemans M, Janssen T, Schoofs L#Comparative peptidomics of Caenorhabditis elegans versus C#briggsae by LC-MALDI-TOF MS Peptides 2009 Mar;30(3):449-57 | |
NP01289 | ASGGMRNALVRF |
12 | Caenorhabditis briggsae | FMRFamide related peptide | FLP-11 | 18760316#Husson SJ, Landuyt B, Nys T, Baggerman G, Boonen K, Clynen E, Lindemans M, Janssen T, Schoofs L#Comparative peptidomics of Caenorhabditis elegans versus C#briggsae by LC-MALDI-TOF MS Peptides 2009 Mar;30(3):449-57 | |
NP01290 | RNKFEFIRF |
9 | Caenorhabditis briggsae | FMRFamide related peptide | FLP-12 | 18760316#Husson SJ, Landuyt B, Nys T, Baggerman G, Boonen K, Clynen E, Lindemans M, Janssen T, Schoofs L#Comparative peptidomics of Caenorhabditis elegans versus C#briggsae by LC-MALDI-TOF MS Peptides 2009 Mar;30(3):449-57 | |
NP01291 | AADGAPLIRF |
10 | Caenorhabditis briggsae | FMRFamide related peptide | FLP-13 | 18760316#Husson SJ, Landuyt B, Nys T, Baggerman G, Boonen K, Clynen E, Lindemans M, Janssen T, Schoofs L#Comparative peptidomics of Caenorhabditis elegans versus C#briggsae by LC-MALDI-TOF MS Peptides 2009 Mar;30(3):449-57 | |
NP01292 | AAPSAPLIRF |
10 | Caenorhabditis briggsae | FMRFamide related peptide | FLP-13 | 18760316#Husson SJ, Landuyt B, Nys T, Baggerman G, Boonen K, Clynen E, Lindemans M, Janssen T, Schoofs L#Comparative peptidomics of Caenorhabditis elegans versus C#briggsae by LC-MALDI-TOF MS Peptides 2009 Mar;30(3):449-57 | |
NP01293 | APEASPFIRF |
10 | Caenorhabditis briggsae | FMRFamide related peptide | FLP-13 | 18760316#Husson SJ, Landuyt B, Nys T, Baggerman G, Boonen K, Clynen E, Lindemans M, Janssen T, Schoofs L#Comparative peptidomics of Caenorhabditis elegans versus C#briggsae by LC-MALDI-TOF MS Peptides 2009 Mar;30(3):449-57 | |
NP01294 | ASPSAPLIRF |
10 | Caenorhabditis briggsae | FMRFamide related peptide | FLP-13 | 18760316#Husson SJ, Landuyt B, Nys T, Baggerman G, Boonen K, Clynen E, Lindemans M, Janssen T, Schoofs L#Comparative peptidomics of Caenorhabditis elegans versus C#briggsae by LC-MALDI-TOF MS Peptides 2009 Mar;30(3):449-57 | |
NP01295 | ASSAPLIRF |
9 | Caenorhabditis briggsae | FMRFamide related peptide | FLP-13 | 18760316#Husson SJ, Landuyt B, Nys T, Baggerman G, Boonen K, Clynen E, Lindemans M, Janssen T, Schoofs L#Comparative peptidomics of Caenorhabditis elegans versus C#briggsae by LC-MALDI-TOF MS Peptides 2009 Mar;30(3):449-57 | |
NP01296 | GGPQGPLRF |
9 | Caenorhabditis briggsae | FMRFamide related peptide | FLP-15 | 18760316#Husson SJ, Landuyt B, Nys T, Baggerman G, Boonen K, Clynen E, Lindemans M, Janssen T, Schoofs L#Comparative peptidomics of Caenorhabditis elegans versus C#briggsae by LC-MALDI-TOF MS Peptides 2009 Mar;30(3):449-57 | |
NP01297 | RGPSGPLRF |
9 | Caenorhabditis briggsae | FMRFamide related peptide | FLP-15 | 18760316#Husson SJ, Landuyt B, Nys T, Baggerman G, Boonen K, Clynen E, Lindemans M, Janssen T, Schoofs L#Comparative peptidomics of Caenorhabditis elegans versus C#briggsae by LC-MALDI-TOF MS Peptides 2009 Mar;30(3):449-57 | |
NP01298 | AYFDEKKSVPGVLRF |
15 | Caenorhabditis briggsae | FMRFamide related peptide | FLP-18 | 18760316#Husson SJ, Landuyt B, Nys T, Baggerman G, Boonen K, Clynen E, Lindemans M, Janssen T, Schoofs L#Comparative peptidomics of Caenorhabditis elegans versus C#briggsae by LC-MALDI-TOF MS Peptides 2009 Mar;30(3):449-57 | |
NP01299 | DFDGAMPGVLRF |
12 | Caenorhabditis briggsae | FMRFamide related peptide | FLP-18 | 18760316#Husson SJ, Landuyt B, Nys T, Baggerman G, Boonen K, Clynen E, Lindemans M, Janssen T, Schoofs L#Comparative peptidomics of Caenorhabditis elegans versus C#briggsae by LC-MALDI-TOF MS Peptides 2009 Mar;30(3):449-57 | |
NP01300 | DVPGVLRF |
8 | Caenorhabditis briggsae | FMRFamide related peptide | FLP-18 | 18760316#Husson SJ, Landuyt B, Nys T, Baggerman G, Boonen K, Clynen E, Lindemans M, Janssen T, Schoofs L#Comparative peptidomics of Caenorhabditis elegans versus C#briggsae by LC-MALDI-TOF MS Peptides 2009 Mar;30(3):449-57 | |
NP01301 | EIPGVLRF |
8 | Caenorhabditis briggsae | FMRFamide related peptide | FLP-18 | 18760316#Husson SJ, Landuyt B, Nys T, Baggerman G, Boonen K, Clynen E, Lindemans M, Janssen T, Schoofs L#Comparative peptidomics of Caenorhabditis elegans versus C#briggsae by LC-MALDI-TOF MS Peptides 2009 Mar;30(3):449-57 | |
NP01302 | SEVPGVLRF |
9 | Caenorhabditis briggsae | FMRFamide related peptide | FLP-18 | 18760316#Husson SJ, Landuyt B, Nys T, Baggerman G, Boonen K, Clynen E, Lindemans M, Janssen T, Schoofs L#Comparative peptidomics of Caenorhabditis elegans versus C#briggsae by LC-MALDI-TOF MS Peptides 2009 Mar;30(3):449-57 | |
NP01303 | SVPGVLRF |
8 | Caenorhabditis briggsae | FMRFamide related peptide | FLP-18 | 18760316#Husson SJ, Landuyt B, Nys T, Baggerman G, Boonen K, Clynen E, Lindemans M, Janssen T, Schoofs L#Comparative peptidomics of Caenorhabditis elegans versus C#briggsae by LC-MALDI-TOF MS Peptides 2009 Mar;30(3):449-57 | |
NP01304 | ASWASSVRF |
9 | Caenorhabditis briggsae | FMRFamide related peptide | FLP-19 | 18760316#Husson SJ, Landuyt B, Nys T, Baggerman G, Boonen K, Clynen E, Lindemans M, Janssen T, Schoofs L#Comparative peptidomics of Caenorhabditis elegans versus C#briggsae by LC-MALDI-TOF MS Peptides 2009 Mar;30(3):449-57 | |
NP01305 | AGAGEPLAFSPDMLSLRF |
18 | Caenorhabditis briggsae | FMRFamide related peptide | FLP-26 | 18760316#Husson SJ, Landuyt B, Nys T, Baggerman G, Boonen K, Clynen E, Lindemans M, Janssen T, Schoofs L#Comparative peptidomics of Caenorhabditis elegans versus C#briggsae by LC-MALDI-TOF MS Peptides 2009 Mar;30(3):449-57 | |
NP01306 | EFNADDLTLRF |
11 | Caenorhabditis briggsae | FMRFamide related peptide | FLP-26 | 18760316#Husson SJ, Landuyt B, Nys T, Baggerman G, Boonen K, Clynen E, Lindemans M, Janssen T, Schoofs L#Comparative peptidomics of Caenorhabditis elegans versus C#briggsae by LC-MALDI-TOF MS Peptides 2009 Mar;30(3):449-57 | |
NP01307 | APNRVLMRF |
9 | Caenorhabditis briggsae | FMRFamide related peptide | FLP-28 | 18760316#Husson SJ, Landuyt B, Nys T, Baggerman G, Boonen K, Clynen E, Lindemans M, Janssen T, Schoofs L#Comparative peptidomics of Caenorhabditis elegans versus C#briggsae by LC-MALDI-TOF MS Peptides 2009 Mar;30(3):449-57 | |
NP01308 | ASPSFIRF |
8 | Caenorhabditis briggsae | FMRFamide related peptide | FLP-4 | 18760316#Husson SJ, Landuyt B, Nys T, Baggerman G, Boonen K, Clynen E, Lindemans M, Janssen T, Schoofs L#Comparative peptidomics of Caenorhabditis elegans versus C#briggsae by LC-MALDI-TOF MS Peptides 2009 Mar;30(3):449-57 | |
NP01309 | AGAKFIRF |
8 | Caenorhabditis briggsae | FMRFamide related peptide | FLP-5 | 18760316#Husson SJ, Landuyt B, Nys T, Baggerman G, Boonen K, Clynen E, Lindemans M, Janssen T, Schoofs L#Comparative peptidomics of Caenorhabditis elegans versus C#briggsae by LC-MALDI-TOF MS Peptides 2009 Mar;30(3):449-57 | |
NP01310 | APKPKFIRF |
9 | Caenorhabditis briggsae | FMRFamide related peptide | FLP-5 | 18760316#Husson SJ, Landuyt B, Nys T, Baggerman G, Boonen K, Clynen E, Lindemans M, Janssen T, Schoofs L#Comparative peptidomics of Caenorhabditis elegans versus C#briggsae by LC-MALDI-TOF MS Peptides 2009 Mar;30(3):449-57 | |
NP01311 | GAKFIRF |
7 | Caenorhabditis briggsae | FMRFamide related peptide | FLP-5 | 18760316#Husson SJ, Landuyt B, Nys T, Baggerman G, Boonen K, Clynen E, Lindemans M, Janssen T, Schoofs L#Comparative peptidomics of Caenorhabditis elegans versus C#briggsae by LC-MALDI-TOF MS Peptides 2009 Mar;30(3):449-57 | |
NP01312 | KPSFVRF |
7 | Caenorhabditis briggsae | FMRFamide related peptide | FLP-9 | 18760316#Husson SJ, Landuyt B, Nys T, Baggerman G, Boonen K, Clynen E, Lindemans M, Janssen T, Schoofs L#Comparative peptidomics of Caenorhabditis elegans versus C#briggsae by LC-MALDI-TOF MS Peptides 2009 Mar;30(3):449-57 | |
NP01313 | SPREPIRF |
8 | Caenorhabditis briggsae | FMRFamide related peptide | FMRFamide-like peptide | 18760316#Husson SJ, Landuyt B, Nys T, Baggerman G, Boonen K, Clynen E, Lindemans M, Janssen T, Schoofs L#Comparative peptidomics of Caenorhabditis elegans versus C#briggsae by LC-MALDI-TOF MS Peptides 2009 Mar;30(3):449-57 | |
NP01314 | SPSAAPLIRF |
10 | Caenorhabditis briggsae | FMRFamide related peptide | FMRFamide-like peptide | 18760316#Husson SJ, Landuyt B, Nys T, Baggerman G, Boonen K, Clynen E, Lindemans M, Janssen T, Schoofs L#Comparative peptidomics of Caenorhabditis elegans versus C#briggsae by LC-MALDI-TOF MS Peptides 2009 Mar;30(3):449-57 | |
NP01315 | KHEYLRF |
7 | Caenorhabditis briggsae | FMRFamide related peptide | Neuropeptide AF2 | 18760316#Husson SJ, Landuyt B, Nys T, Baggerman G, Boonen K, Clynen E, Lindemans M, Janssen T, Schoofs L#Comparative peptidomics of Caenorhabditis elegans versus C#briggsae by LC-MALDI-TOF MS Peptides 2009 Mar;30(3):449-57 | |
NP01316 | NGAPQPFVRF |
10 | Caenorhabditis briggsae | FMRFamide related peptide | Neuropeptide AF22 | 18760316#Husson SJ, Landuyt B, Nys T, Baggerman G, Boonen K, Clynen E, Lindemans M, Janssen T, Schoofs L#Comparative peptidomics of Caenorhabditis elegans versus C#briggsae by LC-MALDI-TOF MS Peptides 2009 Mar;30(3):449-57 | |
NP01317 | SDPNFLRF |
8 | Caenorhabditis briggsae | FMRFamide related peptide | Neuropeptide PF1 | 18760316#Husson SJ, Landuyt B, Nys T, Baggerman G, Boonen K, Clynen E, Lindemans M, Janssen T, Schoofs L#Comparative peptidomics of Caenorhabditis elegans versus C#briggsae by LC-MALDI-TOF MS Peptides 2009 Mar;30(3):449-57 | |
NP01318 | SADPNFLRF |
9 | Caenorhabditis briggsae | FMRFamide related peptide | Neuropeptide PF2 | 18760316#Husson SJ, Landuyt B, Nys T, Baggerman G, Boonen K, Clynen E, Lindemans M, Janssen T, Schoofs L#Comparative peptidomics of Caenorhabditis elegans versus C#briggsae by LC-MALDI-TOF MS Peptides 2009 Mar;30(3):449-57 | |
NP01319 | WANQVRF |
7 | Caenorhabditis briggsae | FMRFamide related peptide | WANQVRF-amide | 18760316#Husson SJ, Landuyt B, Nys T, Baggerman G, Boonen K, Clynen E, Lindemans M, Janssen T, Schoofs L#Comparative peptidomics of Caenorhabditis elegans versus C#briggsae by LC-MALDI-TOF MS Peptides 2009 Mar;30(3):449-57 | |
NP01320 | SDPNFLRFG |
9 | Caenorhabditis elegans | FMRFamide related peptide | FLP-1 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
NP01321 | SQPNFLRFG |
9 | Caenorhabditis elegans | FMRFamide related peptide | FLP-1 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
NP01322 | AMRNALVRFG |
10 | Caenorhabditis elegans | FMRFamide related peptide | FLP-11 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
NP01323 | NGAPQPFVRFG |
11 | Caenorhabditis elegans | FMRFamide related peptide | FLP-11 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
NP01324 | RNKFEFIRF |
9 | Caenorhabditis elegans | FMRFamide related peptide | FLP-12 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
NP01325 | AADGAPFIRF |
10 | Caenorhabditis elegans | FMRFamide related peptide | FLP-13 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
NP01326 | APEASPFIRFG |
11 | Caenorhabditis elegans | FMRFamide related peptide | FLP-13 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
NP01327 | ASPSAPFIRF |
10 | Caenorhabditis elegans | FMRFamide related peptide | FLP-13 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
NP01328 | ASSAPFIRF |
9 | Caenorhabditis elegans | FMRFamide related peptide | FLP-13 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
NP01329 | ASSAPLIRFGR |
11 | Caenorhabditis elegans | FMRFamide related peptide | FLP-13 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
NP01330 | SAAAPLIRFG |
10 | Caenorhabditis elegans | FMRFamide related peptide | FLP-13 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
NP01331 | SPSAVPFIRF |
10 | Caenorhabditis elegans | FMRFamide related peptide | FLP-13 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
NP01332 | SPSAVPLIRFG |
11 | Caenorhabditis elegans | FMRFamide related peptide | FLP-13 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
NP01333 | GGPQGPLRF |
9 | Caenorhabditis elegans | FMRFamide related peptide | FLP-15 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
NP01334 | GGPQGPLRFG |
10 | Caenorhabditis elegans | FMRFamide related peptide | FLP-15 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
NP01335 | RGPSGPLRF |
9 | Caenorhabditis elegans | FMRFamide related peptide | FLP-15 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
NP01336 | DFDGAMPGVLRF |
12 | Caenorhabditis elegans | FMRFamide related peptide | FLP-18 | 18760316#Husson SJ, Landuyt B, Nys T, Baggerman G, Boonen K, Clynen E, Lindemans M, Janssen T, Schoofs L#Comparative peptidomics of Caenorhabditis elegans versus C#briggsae by LC-MALDI-TOF MS Peptides 2009 Mar;30(3):449-57 | |
NP01337 | DFDGAMPGVLRFG |
13 | Caenorhabditis elegans | FMRFamide related peptide | FLP-18 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
NP01338 | EMPGVLRFG |
9 | Caenorhabditis elegans | FMRFamide related peptide | FLP-18 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
NP01339 | SVPGVLRFG |
9 | Caenorhabditis elegans | FMRFamide related peptide | FLP-18 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
NP01340 | ASWASSVRF |
9 | Caenorhabditis elegans | FMRFamide related peptide | FLP-19 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
NP01341 | WANQVRFG |
8 | Caenorhabditis elegans | FMRFamide related peptide | FLP-19 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
NP01342 | LRGEPIRFG |
9 | Caenorhabditis elegans | FMRFamide related peptide | FLP-2 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
NP01343 | AMMRFG |
6 | Caenorhabditis elegans | FMRFamide related peptide | FLP-20 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
NP01344 | GLGPRPLRF |
9 | Caenorhabditis elegans | FMRFamide related peptide | FLP-21 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
NP01345 | SPREPIRF |
8 | Caenorhabditis elegans | FMRFamide related peptide | FLP-2-1 | 20806053#Jarecki JL, Andersen K, Konop CJ, Knickelbine JJ, Vestling MM, Stretton AO#Mapping neuropeptide expression by mass spectrometry in single dissected identified neurons from the dorsal ganglion of the nematode Ascaris suum#ACS Chem Neurosci 2010 Jul 21;1(7):505-519 | |
NP01346 | SPSAKWMRF |
9 | Caenorhabditis elegans | FMRFamide related peptide | FLP-22 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
NP01347 | SPSAKWMRFG |
10 | Caenorhabditis elegans | FMRFamide related peptide | FLP-22 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
NP01348 | VPSAGDMMVRFG |
12 | Caenorhabditis elegans | FMRFamide related peptide | FLP-24 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
NP01349 | ASYDYIRF |
8 | Caenorhabditis elegans | FMRFamide related peptide | FLP-25 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
NP01350 | DYDFVRF |
7 | Caenorhabditis elegans | FMRFamide related peptide | FLP-25 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
NP01351 | DYDFVRFG |
8 | Caenorhabditis elegans | FMRFamide related peptide | FLP-25 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
NP01352 | EFNADDLTLRFG |
12 | Caenorhabditis elegans | FMRFamide related peptide | FLP-26 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
NP01353 | FRLPFQFFGANEDFNSGLT |
19 | Caenorhabditis elegans | FMRFamide related peptide | FLP-26 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
NP01354 | GGAGEPLAFSPDMLSLRFG |
19 | Caenorhabditis elegans | FMRFamide related peptide | FLP-26 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
NP01355 | APNRVLMRF |
9 | Caenorhabditis elegans | FMRFamide related peptide | FLP-28 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
NP01356 | APNRVLMRFG |
10 | Caenorhabditis elegans | FMRFamide related peptide | FLP-28 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
NP01357 | VLMRFG |
6 | Caenorhabditis elegans | FMRFamide related peptide | FLP-28 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
NP01358 | ASEDALFGTMRFG |
13 | Caenorhabditis elegans | FMRFamide related peptide | FLP-3 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
NP01359 | NPLGTMRFG |
9 | Caenorhabditis elegans | FMRFamide related peptide | FLP-3 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
NP01360 | AMRNSLVRF |
9 | Caenorhabditis elegans | FMRFamide related peptide | FLP-32 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
NP01361 | APLEGFEDMSGFLRTIDGIQKPRF |
24 | Caenorhabditis elegans | FMRFamide related peptide | FLP-33 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
NP01362 | ASPSFIRF |
8 | Caenorhabditis elegans | FMRFamide related peptide | FLP-4 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
NP01363 | AGAKFIRFG |
9 | Caenorhabditis elegans | FMRFamide related peptide | FLP-5 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
NP01364 | APKPKFIRFG |
10 | Caenorhabditis elegans | FMRFamide related peptide | FLP-5 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
NP01365 | KSAYMRFG |
8 | Caenorhabditis elegans | FMRFamide related peptide | FLP-6 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
NP01366 | SPMQRSSMVRFG |
12 | Caenorhabditis elegans | FMRFamide related peptide | FLP-7 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
NP01367 | TPMQRSSMVRFG |
12 | Caenorhabditis elegans | FMRFamide related peptide | FLP-7 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
NP01368 | SPMQRSSMVRF |
11 | Caenorhabditis elegans | FMRFamide related peptide | FLP-7-1 | 20806053#Jarecki JL, Andersen K, Konop CJ, Knickelbine JJ, Vestling MM, Stretton AO#Mapping neuropeptide expression by mass spectrometry in single dissected identified neurons from the dorsal ganglion of the nematode Ascaris suum#ACS Chem Neurosci 2010 Jul 21;1(7):505-519 | |
NP01369 | TPMQRSSMVRF |
11 | Caenorhabditis elegans | FMRFamide related peptide | FLP-7-2 | 20806053#Jarecki JL, Andersen K, Konop CJ, Knickelbine JJ, Vestling MM, Stretton AO#Mapping neuropeptide expression by mass spectrometry in single dissected identified neurons from the dorsal ganglion of the nematode Ascaris suum#ACS Chem Neurosci 2010 Jul 21;1(7):505-519 | |
NP01370 | SPMERSAMVRF |
11 | Caenorhabditis elegans | FMRFamide related peptide | FLP-7-3 | 20806053#Jarecki JL, Andersen K, Konop CJ, Knickelbine JJ, Vestling MM, Stretton AO#Mapping neuropeptide expression by mass spectrometry in single dissected identified neurons from the dorsal ganglion of the nematode Ascaris suum#ACS Chem Neurosci 2010 Jul 21;1(7):505-519 | |
NP01371 | SPMDRSKMVRF |
11 | Caenorhabditis elegans | FMRFamide related peptide | FLP-7-4 | 20806053#Jarecki JL, Andersen K, Konop CJ, Knickelbine JJ, Vestling MM, Stretton AO#Mapping neuropeptide expression by mass spectrometry in single dissected identified neurons from the dorsal ganglion of the nematode Ascaris suum#ACS Chem Neurosci 2010 Jul 21;1(7):505-519 | |
NP01372 | KNEFIRF |
7 | Caenorhabditis elegans | FMRFamide related peptide | FLP-8 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
NP01373 | LRGEPIRF |
8 | Caenorhabditis elegans | FMRFamide related peptide | FMRFamide-like peptide | 20806053#Jarecki JL, Andersen K, Konop CJ, Knickelbine JJ, Vestling MM, Stretton AO#Mapping neuropeptide expression by mass spectrometry in single dissected identified neurons from the dorsal ganglion of the nematode Ascaris suum#ACS Chem Neurosci 2010 Jul 21;1(7):505-519 | |
NP01374 | GAMPGVLRF |
9 | Caenorhabditis elegans | FMRFamide related peptide | FMRFamide-related peptide | 16061202#Husson SJ, Clynen E, Baggerman G, De Loof A, Schoofs L#Discovering neuropeptides in Caenorhabditis elegans by two dimensional liquid chromatography and mass spectrometry#Biochem Biophys Res Commun 2005 Sep 16;335(1):76-86 | |
NP01375 | SYFDEKKSVPGVLRF |
15 | Caenorhabditis elegans | FMRFamide related peptide | FMRFamide-related peptide | 16061202#Husson SJ, Clynen E, Baggerman G, De Loof A, Schoofs L#Discovering neuropeptides in Caenorhabditis elegans by two dimensional liquid chromatography and mass spectrometry#Biochem Biophys Res Commun 2005 Sep 16;335(1):76-86 | |
NP01376 | AVPGVLRF |
8 | Caenorhabditis elegans | FMRFamide related peptide | Neuropeptide AF3 | 12865086#Moffett CL, Beckett AM, Mousley A, Geary TG, Marks NJ, Halton DW, Thompson DP, Maule AG#The ovijector of Ascaris suum: multiple response types revealed by Caenorhabditis elegans FMRFamide-related peptides#Int J Parasitol 2003 Jul 30;33(8):859-76 | |
NP01377 | GDVPGVLRF |
9 | Caenorhabditis elegans | FMRFamide related peptide | Neuropeptide AF4 | 12865086#Moffett CL, Beckett AM, Mousley A, Geary TG, Marks NJ, Halton DW, Thompson DP, Maule AG#The ovijector of Ascaris suum: multiple response types revealed by Caenorhabditis elegans FMRFamide-related peptides#Int J Parasitol 2003 Jul 30;33(8):859-76 | |
NP01378 | KPNFIRF |
7 | Caenorhabditis elegans | FMRFamide related peptide | Neuropeptide PF4 | 12865086#Moffett CL, Beckett AM, Mousley A, Geary TG, Marks NJ, Halton DW, Thompson DP, Maule AG#The ovijector of Ascaris suum: multiple response types revealed by Caenorhabditis elegans FMRFamide-related peptides#Int J Parasitol 2003 Jul 30;33(8):859-76 | |
NP01379 | FNADDLTLRF |
10 | Caenorhabditis elegans | FMRFamide related peptide | Novel FaRP | 16061202#Husson SJ, Clynen E, Baggerman G, De Loof A, Schoofs L#Discovering neuropeptides in Caenorhabditis elegans by two dimensional liquid chromatography and mass spectrometry#Biochem Biophys Res Commun 2005 Sep 16;335(1):76-86 | |
NP01380 | AHKNFLRF |
8 | Callinectes sapidus | FMRFamide related peptide | FMRFamide-like peptide | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
NP01381 | APQGNFLRF |
9 | Callinectes sapidus | FMRFamide related peptide | FMRFamide-like peptide | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
NP01382 | APQRNFLRF |
9 | Callinectes sapidus | FMRFamide related peptide | FMRFamide-like peptide | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
NP01383 | AYNRSFLRF |
9 | Callinectes sapidus | FMRFamide related peptide | FMRFamide-like peptide | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
NP01384 | DDNFLRF |
7 | Callinectes sapidus | FMRFamide related peptide | FMRFamide-like peptide | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
NP01385 | DENRNFLRF |
9 | Callinectes sapidus | FMRFamide related peptide | FMRFamide-like peptide | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
NP01386 | DRNFLRF |
7 | Callinectes sapidus | FMRFamide related peptide | FMRFamide-like peptide | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
NP01387 | FDDFLRF |
7 | Callinectes sapidus | FMRFamide related peptide | FMRFamide-like peptide | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
NP01388 | GAHKNYLRF |
9 | Callinectes sapidus | FMRFamide related peptide | FMRFamide-like peptide | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
NP01389 | GDRNFLRF |
8 | Callinectes sapidus | FMRFamide related peptide | FMRFamide-like peptide | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
NP01390 | GHDFEVFLRF |
10 | Callinectes sapidus | FMRFamide related peptide | FMRFamide-like peptide | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
NP01391 | GLSRNYLRF |
9 | Callinectes sapidus | FMRFamide related peptide | FMRFamide-like peptide | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
NP01392 | GNNFLRF |
7 | Callinectes sapidus | FMRFamide related peptide | FMRFamide-like peptide | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
NP01393 | GNRNFLRF |
8 | Callinectes sapidus | FMRFamide related peptide | FMRFamide-like peptide | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
NP01394 | GPFLRF |
6 | Callinectes sapidus | FMRFamide related peptide | FMRFamide-like peptide | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
NP01395 | GRPNFLRF |
8 | Callinectes sapidus | FMRFamide related peptide | FMRFamide-like peptide | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
NP01396 | GYSKNYLRF |
9 | Callinectes sapidus | FMRFamide related peptide | FMRFamide-like peptide | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
NP01397 | NFLRF |
5 | Callinectes sapidus | FMRFamide related peptide | FMRFamide-like peptide | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
NP01398 | NQPNFLRF |
8 | Callinectes sapidus | FMRFamide related peptide | FMRFamide-like peptide | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
NP01399 | NRNFLRF |
7 | Callinectes sapidus | FMRFamide related peptide | FMRFamide-like peptide | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
NP01400 | NRSFLRF |
7 | Callinectes sapidus | FMRFamide related peptide | FMRFamide-like peptide | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
NP01401 | NVGSHGFLRF |
10 | Callinectes sapidus | FMRFamide related peptide | FMRFamide-like peptide | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
NP01402 | PGVNFLRF |
8 | Callinectes sapidus | FMRFamide related peptide | FMRFamide-like peptide | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
NP01403 | PSDNFLRF |
8 | Callinectes sapidus | FMRFamide related peptide | FMRFamide-like peptide | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
NP01404 | QGNFLRF |
7 | Callinectes sapidus | FMRFamide related peptide | FMRFamide-like peptide | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
NP01405 | RNFLRF |
6 | Callinectes sapidus | FMRFamide related peptide | FMRFamide-like peptide | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
NP01406 | RQFLRF |
6 | Callinectes sapidus | FMRFamide related peptide | FMRFamide-like peptide | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
NP01407 | SENRNFLRF |
9 | Callinectes sapidus | FMRFamide related peptide | FMRFamide-like peptide | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
NP01408 | SKNYLRF |
7 | Callinectes sapidus | FMRFamide related peptide | FMRFamide-like peptide | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
NP01409 | SPRNFLRF |
8 | Callinectes sapidus | FMRFamide related peptide | FMRFamide-like peptide | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
NP01410 | SQPSKNYLRF |
10 | Callinectes sapidus | FMRFamide related peptide | FMRFamide-like peptide | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
NP01411 | THPFLRF |
7 | Callinectes sapidus | FMRFamide related peptide | FMRFamide-like peptide | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
NP01412 | YEQDFLRF |
8 | Callinectes sapidus | FMRFamide related peptide | FMRFamide-like peptide | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
NP01413 | YGAHVFLRF |
9 | Callinectes sapidus | FMRFamide related peptide | FMRFamide-like peptide | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
NP01414 | YGNRSFLRF |
9 | Callinectes sapidus | FMRFamide related peptide | FMRFamide-like peptide | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
NP01415 | AHRNFLRF |
8 | Callinectes sapidus | FMRFamide related peptide | RFamide | 21740068#Hui L, Cunningham R, Zhang Z, Cao W, Jia C, Li L#Discovery and characterization of the Crustacean hyperglycemic hormone precursor related peptides (CPRP) and orcokinin neuropeptides in the sinus glands of the blue crab Callinectes sapidus using multiple tandem mass spectrometry techniques#J Proteome Res 2011 Sep 2;10(9):4219-29 | |
NP01416 | DARTAPLRLRF |
11 | Callinectes sapidus | FMRFamide related peptide | RFamide | 21740068#Hui L, Cunningham R, Zhang Z, Cao W, Jia C, Li L#Discovery and characterization of the Crustacean hyperglycemic hormone precursor related peptides (CPRP) and orcokinin neuropeptides in the sinus glands of the blue crab Callinectes sapidus using multiple tandem mass spectrometry techniques#J Proteome Res 2011 Sep 2;10(9):4219-29 | |
NP01417 | DHVPFLRF |
8 | Callinectes sapidus | FMRFamide related peptide | RFamide | 21740068#Hui L, Cunningham R, Zhang Z, Cao W, Jia C, Li L#Discovery and characterization of the Crustacean hyperglycemic hormone precursor related peptides (CPRP) and orcokinin neuropeptides in the sinus glands of the blue crab Callinectes sapidus using multiple tandem mass spectrometry techniques#J Proteome Res 2011 Sep 2;10(9):4219-29 | |
NP01418 | ETNFLRF |
7 | Callinectes sapidus | FMRFamide related peptide | RFamide | 21740068#Hui L, Cunningham R, Zhang Z, Cao W, Jia C, Li L#Discovery and characterization of the Crustacean hyperglycemic hormone precursor related peptides (CPRP) and orcokinin neuropeptides in the sinus glands of the blue crab Callinectes sapidus using multiple tandem mass spectrometry techniques#J Proteome Res 2011 Sep 2;10(9):4219-29 | |
NP01419 | FTSKNYLRF |
9 | Callinectes sapidus | FMRFamide related peptide | RFamide | 21740068#Hui L, Cunningham R, Zhang Z, Cao W, Jia C, Li L#Discovery and characterization of the Crustacean hyperglycemic hormone precursor related peptides (CPRP) and orcokinin neuropeptides in the sinus glands of the blue crab Callinectes sapidus using multiple tandem mass spectrometry techniques#J Proteome Res 2011 Sep 2;10(9):4219-29 | |
NP01420 | GHRNFLRF |
8 | Callinectes sapidus | FMRFamide related peptide | RFamide | 21740068#Hui L, Cunningham R, Zhang Z, Cao W, Jia C, Li L#Discovery and characterization of the Crustacean hyperglycemic hormone precursor related peptides (CPRP) and orcokinin neuropeptides in the sinus glands of the blue crab Callinectes sapidus using multiple tandem mass spectrometry techniques#J Proteome Res 2011 Sep 2;10(9):4219-29 | |
NP01421 | YGSDRNFLRF |
10 | Callinectes sapidus | FMRFamide related peptide | RFamide | 21740068#Hui L, Cunningham R, Zhang Z, Cao W, Jia C, Li L#Discovery and characterization of the Crustacean hyperglycemic hormone precursor related peptides (CPRP) and orcokinin neuropeptides in the sinus glands of the blue crab Callinectes sapidus using multiple tandem mass spectrometry techniques#J Proteome Res 2011 Sep 2;10(9):4219-29 | |
NP01422 | DLDSVLDPSIF |
11 | Callinectes sapidus | FMRFamide related peptide | SIFamide | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
NP01423 | GYRKPPFNGSIF |
12 | Callinectes sapidus | FMRFamide related peptide | SIFamide | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
NP01424 | DRNFLRF |
7 | Cancer borealis | FMRFamide related peptide | DF2 | 18700782#Behrens HL, Chen R, Li L#Combining microdialysis, NanoLC-MS, and MALDI-TOF/TOF to detect neuropeptides secreted in the crab, Cancer borealis#Anal Chem 2008 Sep 15;80(18):6949-58 | |
NP01425 | TNRNFLRF |
8 | Cancer borealis | FMRFamide related peptide | FMRFamide-like neuropeptide 4 | 18700782#Behrens HL, Chen R, Li L#Combining microdialysis, NanoLC-MS, and MALDI-TOF/TOF to detect neuropeptides secreted in the crab, Cancer borealis#Anal Chem 2008 Sep 15;80(18):6949-58 | |
NP01426 | APQRNFLRF |
9 | Cancer borealis | FMRFamide related peptide | RFamide | 23544036#Sturm RM, Greer T, Chen R, Hensen B, Li L#Comparison of NIMS and MALDI platforms for neuropeptide and lipid mass spectrometric imaging in C#borealis brain tissue Anal Methods 2013;5(6):1623-1628 | |
NP01427 | APRNFLRF |
8 | Cancer borealis | FMRFamide related peptide | RFamide | 19185513#Chen R, Ma M, Hui L, Zhang J, Li L#Measurement of neuropeptides in crustacean hemolymph via MALDI mass spectrometry#J Am Soc Mass Spectrom 2009 Apr;20(4):708-18 | |
NP01428 | AYNRSFLRF |
9 | Cancer borealis | FMRFamide related peptide | RFamide | 17381149#DeKeyser SS, Kutz-Naber KK, Schmidt JJ, Barrett-Wilt GA, Li L#Imaging mass spectrometry of neuropeptides in decapod crustacean neuronal tissues#J Proteome Res 2007 May;6(5):1782-91 | |
NP01429 | DGGRNFLRF |
9 | Cancer borealis | FMRFamide related peptide | RFamide | 18700782#Behrens HL, Chen R, Li L#Combining microdialysis, NanoLC-MS, and MALDI-TOF/TOF to detect neuropeptides secreted in the crab, Cancer borealis#Anal Chem 2008 Sep 15;80(18):6949-58 | |
NP01430 | DVRTPALRLRF |
11 | Cancer borealis | FMRFamide related peptide | RFamide | 23544036#Sturm RM, Greer T, Chen R, Hensen B, Li L#Comparison of NIMS and MALDI platforms for neuropeptide and lipid mass spectrometric imaging in C#borealis brain tissue Anal Methods 2013;5(6):1623-1628 | |
NP01431 | GAHKNYLRF |
9 | Cancer borealis | FMRFamide related peptide | RFamide | 19185513#Chen R, Ma M, Hui L, Zhang J, Li L#Measurement of neuropeptides in crustacean hemolymph via MALDI mass spectrometry#J Am Soc Mass Spectrom 2009 Apr;20(4):708-18 | |
NP01432 | GGRNFLRF |
8 | Cancer borealis | FMRFamide related peptide | RFamide | 18700782#Behrens HL, Chen R, Li L#Combining microdialysis, NanoLC-MS, and MALDI-TOF/TOF to detect neuropeptides secreted in the crab, Cancer borealis#Anal Chem 2008 Sep 15;80(18):6949-58 | |
NP01433 | GNRNFLRF |
8 | Cancer borealis | FMRFamide related peptide | RFamide | 17381149#DeKeyser SS, Kutz-Naber KK, Schmidt JJ, Barrett-Wilt GA, Li L#Imaging mass spectrometry of neuropeptides in decapod crustacean neuronal tissues#J Proteome Res 2007 May;6(5):1782-91 | |
NP01434 | GPRNFLRF |
8 | Cancer borealis | FMRFamide related peptide | RFamide | 19185513#Chen R, Ma M, Hui L, Zhang J, Li L#Measurement of neuropeptides in crustacean hemolymph via MALDI mass spectrometry#J Am Soc Mass Spectrom 2009 Apr;20(4):708-18 | |
NP01435 | GYSKNYLRF |
9 | Cancer borealis | FMRFamide related peptide | RFamide | 17381149#DeKeyser SS, Kutz-Naber KK, Schmidt JJ, Barrett-Wilt GA, Li L#Imaging mass spectrometry of neuropeptides in decapod crustacean neuronal tissues#J Proteome Res 2007 May;6(5):1782-91 | |
NP01436 | NRNFLRF |
7 | Cancer borealis | FMRFamide related peptide | RFamide | 23544036#Sturm RM, Greer T, Chen R, Hensen B, Li L#Comparison of NIMS and MALDI platforms for neuropeptide and lipid mass spectrometric imaging in C#borealis brain tissue Anal Methods 2013;5(6):1623-1628 | |
NP01437 | RNFLRF |
6 | Cancer borealis | FMRFamide related peptide | RFamide | 18700782#Behrens HL, Chen R, Li L#Combining microdialysis, NanoLC-MS, and MALDI-TOF/TOF to detect neuropeptides secreted in the crab, Cancer borealis#Anal Chem 2008 Sep 15;80(18):6949-58 | |
NP01438 | RSFLRF |
6 | Cancer borealis | FMRFamide related peptide | RFamide | 18700782#Behrens HL, Chen R, Li L#Combining microdialysis, NanoLC-MS, and MALDI-TOF/TOF to detect neuropeptides secreted in the crab, Cancer borealis#Anal Chem 2008 Sep 15;80(18):6949-58 | |
NP01439 | SDRNFLRF |
8 | Cancer borealis | FMRFamide related peptide | RFamide | 18700782#Behrens HL, Chen R, Li L#Combining microdialysis, NanoLC-MS, and MALDI-TOF/TOF to detect neuropeptides secreted in the crab, Cancer borealis#Anal Chem 2008 Sep 15;80(18):6949-58 | |
NP01440 | SENRNFLRF |
9 | Cancer borealis | FMRFamide related peptide | RFamide | 18700782#Behrens HL, Chen R, Li L#Combining microdialysis, NanoLC-MS, and MALDI-TOF/TOF to detect neuropeptides secreted in the crab, Cancer borealis#Anal Chem 2008 Sep 15;80(18):6949-58 | |
NP01441 | SGRNFLRF |
8 | Cancer borealis | FMRFamide related peptide | RFamide | 18700782#Behrens HL, Chen R, Li L#Combining microdialysis, NanoLC-MS, and MALDI-TOF/TOF to detect neuropeptides secreted in the crab, Cancer borealis#Anal Chem 2008 Sep 15;80(18):6949-58 | |
NP01442 | SMPSLRLRF |
9 | Cancer borealis | FMRFamide related peptide | RFamide | 23544036#Sturm RM, Greer T, Chen R, Hensen B, Li L#Comparison of NIMS and MALDI platforms for neuropeptide and lipid mass spectrometric imaging in C#borealis brain tissue Anal Methods 2013;5(6):1623-1628 | |
NP01443 | GYRKPPFNGSIF |
12 | Cancer borealis | FMRFamide related peptide | SIFamide | 23544036#Sturm RM, Greer T, Chen R, Hensen B, Li L#Comparison of NIMS and MALDI platforms for neuropeptide and lipid mass spectrometric imaging in C#borealis brain tissue Anal Methods 2013;5(6):1623-1628 | |
NP01444 | SGTGLSATLPQRF |
13 | Carassius auratus | FMRFamide related peptide | Goldfish LPXRFa peptide-3 | 12473095#Sawada K, Ukena K, Satake H, Iwakoshi E, Minakata H, Tsutsui K#Novel fish hypothalamic neuropeptide#Eur J Biochem 2002 Dec;269(24):6000-8 | |
NP01445 | APQGNFLRF |
9 | Carcinus maenas | FMRFamide related peptide | FMRFamide-like peptide | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
NP01446 | APQRNFLRF |
9 | Carcinus maenas | FMRFamide related peptide | FMRFamide-like peptide | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
NP01447 | DARTPALRLRF |
11 | Carcinus maenas | FMRFamide related peptide | FMRFamide-like peptide | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
NP01448 | DGNRNFLRF |
9 | Carcinus maenas | FMRFamide related peptide | FMRFamide-like peptide | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
NP01449 | DRNFLRF |
7 | Carcinus maenas | FMRFamide related peptide | FMRFamide-like peptide | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
NP01450 | EMPSLRLRF |
9 | Carcinus maenas | FMRFamide related peptide | FMRFamide-like peptide | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
NP01451 | GAHKNYLRF |
9 | Carcinus maenas | FMRFamide related peptide | FMRFamide-like peptide | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
NP01452 | GLSRNYLRF |
9 | Carcinus maenas | FMRFamide related peptide | FMRFamide-like peptide | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
NP01453 | NRNFLRF |
7 | Carcinus maenas | FMRFamide related peptide | FMRFamide-like peptide | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
NP01454 | NRSFLRF |
7 | Carcinus maenas | FMRFamide related peptide | FMRFamide-like peptide | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
NP01455 | QGNFLRF |
7 | Carcinus maenas | FMRFamide related peptide | FMRFamide-like peptide | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
NP01456 | RNFLRF |
6 | Carcinus maenas | FMRFamide related peptide | FMRFamide-like peptide | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
NP01457 | SENRNFLRF |
9 | Carcinus maenas | FMRFamide related peptide | FMRFamide-like peptide | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
NP01458 | SMPSLRLRF |
9 | Carcinus maenas | FMRFamide related peptide | FMRFamide-like peptide | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
NP01459 | SRNYLRF |
7 | Carcinus maenas | FMRFamide related peptide | FMRFamide-like peptide | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
NP01460 | YGNRSFLRF |
9 | Carcinus maenas | FMRFamide related peptide | FMRFamide-like peptide | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
NP01461 | GYRKPPFNGSIF |
12 | Carcinus maenas | FMRFamide related peptide | SIFamide | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
NP01462 | RKPPFNGSIF |
10 | Carcinus maenas | FMRFamide related peptide | SIFamide | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
NP01463 | VYRKPPFNGSIF |
12 | Carcinus maenas | FMRFamide related peptide | SIFamide | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
NP01464 | ARSSIQSLLNLPQ |
13 | Coturnix coturnix japonica | FMRFamide related peptide | GnIH-RP2 | 20298575#Scholz B, Alm H, Mattsson A, Nilsson A, Kultima K, Savitski MM, Fälth M, Sköld K, Brunström B, Andren PE, Dencker L#Neuropeptidomic analysis of the embryonic Japanese quail diencephalon#BMC Dev Biol 2010 Mar 18;10:30 | |
NP01465 | SPLARSSIQSLLNLPQ |
16 | Coturnix coturnix japonica | FMRFamide related peptide | GnIH-RP2 | 20298575#Scholz B, Alm H, Mattsson A, Nilsson A, Kultima K, Savitski MM, Fälth M, Sköld K, Brunström B, Andren PE, Dencker L#Neuropeptidomic analysis of the embryonic Japanese quail diencephalon#BMC Dev Biol 2010 Mar 18;10:30 | |
NP01466 | SALNKNFIRF |
10 | Daphnia pulex | FMRFamide related peptide | FIRFamide1 | 21830762#Dircksen H, Neupert S, Predel R, Verleyen P, Huybrechts J, Strauss J, Hauser F, Stafflinger E, Schneider M, Pauwels K, Schoofs L, Grimmelikhuijzen CJ#Genomics, transcriptomics, and peptidomics of Daphnia pulex neuropeptides and protein hormones#J Proteome Res 2011 Oct 7;10(10):4478-504 | |
NP01467 | DEERSFHPARPSRSLRSNFIRF |
22 | Daphnia pulex | FMRFamide related peptide | FIRFamide2 | 21830762#Dircksen H, Neupert S, Predel R, Verleyen P, Huybrechts J, Strauss J, Hauser F, Stafflinger E, Schneider M, Pauwels K, Schoofs L, Grimmelikhuijzen CJ#Genomics, transcriptomics, and peptidomics of Daphnia pulex neuropeptides and protein hormones#J Proteome Res 2011 Oct 7;10(10):4478-504 | |
NP01468 | TRKLPFNGSIF |
11 | Daphnia pulex | FMRFamide related peptide | SIFamide | 21830762#Dircksen H, Neupert S, Predel R, Verleyen P, Huybrechts J, Strauss J, Hauser F, Stafflinger E, Schneider M, Pauwels K, Schoofs L, Grimmelikhuijzen CJ#Genomics, transcriptomics, and peptidomics of Daphnia pulex neuropeptides and protein hormones#J Proteome Res 2011 Oct 7;10(10):4478-504 | |
NP01469 | APSQDFMRF |
9 | Delia radicum | FMRFamide related peptide | FMRFamide | 20869420#Audsley N, Matthews HJ, Down RE, Weaver RJ#Neuropeptides associated with the central nervous system of the cabbage root fly, Delia radicum (L)#Peptides 2011 Mar;32(3):434-40 | |
NP01470 | EQDFMRF |
7 | Delia radicum | FMRFamide related peptide | FMRFamide | 20869420#Audsley N, Matthews HJ, Down RE, Weaver RJ#Neuropeptides associated with the central nervous system of the cabbage root fly, Delia radicum (L)#Peptides 2011 Mar;32(3):434-40 | |
NP01471 | KPNQDFMRF |
9 | Delia radicum | FMRFamide related peptide | FMRFamide | 20869420#Audsley N, Matthews HJ, Down RE, Weaver RJ#Neuropeptides associated with the central nervous system of the cabbage root fly, Delia radicum (L)#Peptides 2011 Mar;32(3):434-40 | |
NP01472 | SPKQDFMRF |
9 | Delia radicum | FMRFamide related peptide | SPKQDFMRF-amide | 20869420#Audsley N, Matthews HJ, Down RE, Weaver RJ#Neuropeptides associated with the central nervous system of the cabbage root fly, Delia radicum (L)#Peptides 2011 Mar;32(3):434-40 | |
NP01473 | AYRKPPFNGSIF |
12 | Drosophila melanogaster | FMRFamide related peptide | SIFamide | 20575072#Carlsson MA, Diesner M, Schachtner J, Nässel DR#Multiple neuropeptides in the Drosophila antennal lobe suggest complex modulatory circuits#J Comp Neurol 2010 Aug 15;518(16):3359-80 | |
NP01474 | GNSFLRF |
7 | Galleria mellonella | FMRFamide related peptide | FLRFamide II | 15706623#Huybrechts J, Verleyen P, Schoofs L#Mass spectrometric analysis of head ganglia and neuroendocrine tissue of larval Galleria mellonella (Arthropoda, Insecta)#J Mass Spectrom 2005 Feb;40(2):271-6 | |
NP01475 | AMVRF |
5 | Galleria mellonella | FMRFamide related peptide | Gam-Neuropeptide F | 15706623#Huybrechts J, Verleyen P, Schoofs L#Mass spectrometric analysis of head ganglia and neuroendocrine tissue of larval Galleria mellonella (Arthropoda, Insecta)#J Mass Spectrom 2005 Feb;40(2):271-6 | |
NP01476 | APQRNFLRF |
9 | Homarus americanus | FMRFamide related peptide | FMRFamide-like peptide | 18304551#Ma M, Chen R, Sousa GL, Bors EK, Kwiatkowski MA, Goiney CC, Goy MF, Christie AE, Li L#Mass spectral characterization of peptide transmitters/hormones in the nervous system and neuroendocrine organs of the American lobster Homarus americanus#Gen Comp Endocrinol 2008 Apr 1;156(2):395-409 | |
NP01477 | DRNFLRF |
7 | Homarus americanus | FMRFamide related peptide | FMRFamide-like peptide | 20025296#Chen R, Jiang X, Conaway MC, Mohtashemi I, Hui L, Viner R, Li L#Mass spectral analysis of neuropeptide expression and distribution in the nervous system of the lobster Homarus americanus#J Proteome Res 2010 Feb 5;9(2):818-32 | |
NP01478 | NFLRF |
5 | Homarus americanus | FMRFamide related peptide | FMRFamide-like peptide | 20025296#Chen R, Jiang X, Conaway MC, Mohtashemi I, Hui L, Viner R, Li L#Mass spectral analysis of neuropeptide expression and distribution in the nervous system of the lobster Homarus americanus#J Proteome Res 2010 Feb 5;9(2):818-32 | |
NP01479 | RNFLRF |
6 | Homarus americanus | FMRFamide related peptide | FMRFamide-like peptide | 20025296#Chen R, Jiang X, Conaway MC, Mohtashemi I, Hui L, Viner R, Li L#Mass spectral analysis of neuropeptide expression and distribution in the nervous system of the lobster Homarus americanus#J Proteome Res 2010 Feb 5;9(2):818-32 | |
NP01480 | SKNFLRF |
7 | Homarus americanus | FMRFamide related peptide | FMRFamide-like peptide | 20025296#Chen R, Jiang X, Conaway MC, Mohtashemi I, Hui L, Viner R, Li L#Mass spectral analysis of neuropeptide expression and distribution in the nervous system of the lobster Homarus americanus#J Proteome Res 2010 Feb 5;9(2):818-32 | |
NP01481 | APSKNFLRF |
9 | Homarus americanus | FMRFamide related peptide | FMRFamide-related peptide | 22860213#Jiang X, Chen R, Wang J, Metzler A, Tlusty M, Li L#Mass spectral charting of neuropeptidomic expression in the stomatogastric ganglion at multiple developmental stages of the lobster Homarus americanus#ACS Chem Neurosci 2012 Jun 20;3(6):439-50 | |
NP01482 | DQNRNFLRF |
9 | Homarus americanus | FMRFamide related peptide | FMRFamide-related peptide | 22860213#Jiang X, Chen R, Wang J, Metzler A, Tlusty M, Li L#Mass spectral charting of neuropeptidomic expression in the stomatogastric ganglion at multiple developmental stages of the lobster Homarus americanus#ACS Chem Neurosci 2012 Jun 20;3(6):439-50 | |
NP01483 | DRNYLRF |
7 | Homarus americanus | FMRFamide related peptide | FMRFamide-related peptide | 20025296#Chen R, Jiang X, Conaway MC, Mohtashemi I, Hui L, Viner R, Li L#Mass spectral analysis of neuropeptide expression and distribution in the nervous system of the lobster Homarus americanus#J Proteome Res 2010 Feb 5;9(2):818-32 | |
NP01484 | DTSTPALRLRF |
11 | Homarus americanus | FMRFamide related peptide | FMRFamide-related peptide | 22860213#Jiang X, Chen R, Wang J, Metzler A, Tlusty M, Li L#Mass spectral charting of neuropeptidomic expression in the stomatogastric ganglion at multiple developmental stages of the lobster Homarus americanus#ACS Chem Neurosci 2012 Jun 20;3(6):439-50 | |
NP01485 | FEPSLRLRF |
9 | Homarus americanus | FMRFamide related peptide | FMRFamide-related peptide | 18304551#Ma M, Chen R, Sousa GL, Bors EK, Kwiatkowski MA, Goiney CC, Goy MF, Christie AE, Li L#Mass spectral characterization of peptide transmitters/hormones in the nervous system and neuroendocrine organs of the American lobster Homarus americanus#Gen Comp Endocrinol 2008 Apr 1;156(2):395-409 | |
NP01486 | FSHDRNFLRF |
10 | Homarus americanus | FMRFamide related peptide | FMRFamide-related peptide | 22860213#Jiang X, Chen R, Wang J, Metzler A, Tlusty M, Li L#Mass spectral charting of neuropeptidomic expression in the stomatogastric ganglion at multiple developmental stages of the lobster Homarus americanus#ACS Chem Neurosci 2012 Jun 20;3(6):439-50 | |
NP01487 | GAHKNYLRF |
9 | Homarus americanus | FMRFamide related peptide | FMRFamide-related peptide | 22860213#Jiang X, Chen R, Wang J, Metzler A, Tlusty M, Li L#Mass spectral charting of neuropeptidomic expression in the stomatogastric ganglion at multiple developmental stages of the lobster Homarus americanus#ACS Chem Neurosci 2012 Jun 20;3(6):439-50 | |
NP01488 | GDRNFLRF |
8 | Homarus americanus | FMRFamide related peptide | FMRFamide-related peptide | 22860213#Jiang X, Chen R, Wang J, Metzler A, Tlusty M, Li L#Mass spectral charting of neuropeptidomic expression in the stomatogastric ganglion at multiple developmental stages of the lobster Homarus americanus#ACS Chem Neurosci 2012 Jun 20;3(6):439-50 | |
NP01489 | GGGEYDDYGHLRF |
13 | Homarus americanus | FMRFamide related peptide | FMRFamide-related peptide | 18304551#Ma M, Chen R, Sousa GL, Bors EK, Kwiatkowski MA, Goiney CC, Goy MF, Christie AE, Li L#Mass spectral characterization of peptide transmitters/hormones in the nervous system and neuroendocrine organs of the American lobster Homarus americanus#Gen Comp Endocrinol 2008 Apr 1;156(2):395-409 | |
NP01490 | GGRNFLRF |
8 | Homarus americanus | FMRFamide related peptide | FMRFamide-related peptide | 22860213#Jiang X, Chen R, Wang J, Metzler A, Tlusty M, Li L#Mass spectral charting of neuropeptidomic expression in the stomatogastric ganglion at multiple developmental stages of the lobster Homarus americanus#ACS Chem Neurosci 2012 Jun 20;3(6):439-50 | |
NP01491 | GNRNFLRF |
8 | Homarus americanus | FMRFamide related peptide | FMRFamide-related peptide | 22860213#Jiang X, Chen R, Wang J, Metzler A, Tlusty M, Li L#Mass spectral charting of neuropeptidomic expression in the stomatogastric ganglion at multiple developmental stages of the lobster Homarus americanus#ACS Chem Neurosci 2012 Jun 20;3(6):439-50 | |
NP01492 | GPPSLRLRF |
9 | Homarus americanus | FMRFamide related peptide | FMRFamide-related peptide | 22860213#Jiang X, Chen R, Wang J, Metzler A, Tlusty M, Li L#Mass spectral charting of neuropeptidomic expression in the stomatogastric ganglion at multiple developmental stages of the lobster Homarus americanus#ACS Chem Neurosci 2012 Jun 20;3(6):439-50 | |
NP01493 | GPRNFLRF |
8 | Homarus americanus | FMRFamide related peptide | FMRFamide-related peptide | 20025296#Chen R, Jiang X, Conaway MC, Mohtashemi I, Hui L, Viner R, Li L#Mass spectral analysis of neuropeptide expression and distribution in the nervous system of the lobster Homarus americanus#J Proteome Res 2010 Feb 5;9(2):818-32 | |
NP01494 | GYPSRNYLRF |
10 | Homarus americanus | FMRFamide related peptide | FMRFamide-related peptide | 20025296#Chen R, Jiang X, Conaway MC, Mohtashemi I, Hui L, Viner R, Li L#Mass spectral analysis of neuropeptide expression and distribution in the nervous system of the lobster Homarus americanus#J Proteome Res 2010 Feb 5;9(2):818-32 | |
NP01495 | GYSDRNYLRF |
10 | Homarus americanus | FMRFamide related peptide | FMRFamide-related peptide | 22860213#Jiang X, Chen R, Wang J, Metzler A, Tlusty M, Li L#Mass spectral charting of neuropeptidomic expression in the stomatogastric ganglion at multiple developmental stages of the lobster Homarus americanus#ACS Chem Neurosci 2012 Jun 20;3(6):439-50 | |
NP01496 | HDRNFLRF |
8 | Homarus americanus | FMRFamide related peptide | FMRFamide-related peptide | 20025296#Chen R, Jiang X, Conaway MC, Mohtashemi I, Hui L, Viner R, Li L#Mass spectral analysis of neuropeptide expression and distribution in the nervous system of the lobster Homarus americanus#J Proteome Res 2010 Feb 5;9(2):818-32 | |
NP01497 | QLDRNFLRF |
9 | Homarus americanus | FMRFamide related peptide | FMRFamide-related peptide | 20025296#Chen R, Jiang X, Conaway MC, Mohtashemi I, Hui L, Viner R, Li L#Mass spectral analysis of neuropeptide expression and distribution in the nervous system of the lobster Homarus americanus#J Proteome Res 2010 Feb 5;9(2):818-32 | |
NP01498 | QPRNFLRF |
8 | Homarus americanus | FMRFamide related peptide | FMRFamide-related peptide | 20025296#Chen R, Jiang X, Conaway MC, Mohtashemi I, Hui L, Viner R, Li L#Mass spectral analysis of neuropeptide expression and distribution in the nervous system of the lobster Homarus americanus#J Proteome Res 2010 Feb 5;9(2):818-32 | |
NP01499 | SDRNYLRF |
8 | Homarus americanus | FMRFamide related peptide | FMRFamide-related peptide | 20025296#Chen R, Jiang X, Conaway MC, Mohtashemi I, Hui L, Viner R, Li L#Mass spectral analysis of neuropeptide expression and distribution in the nervous system of the lobster Homarus americanus#J Proteome Res 2010 Feb 5;9(2):818-32 | |
NP01500 | SGRNFLRF |
8 | Homarus americanus | FMRFamide related peptide | FMRFamide-related peptide | 22860213#Jiang X, Chen R, Wang J, Metzler A, Tlusty M, Li L#Mass spectral charting of neuropeptidomic expression in the stomatogastric ganglion at multiple developmental stages of the lobster Homarus americanus#ACS Chem Neurosci 2012 Jun 20;3(6):439-50 | |
NP01501 | SMPSLRLRF |
9 | Homarus americanus | FMRFamide related peptide | FMRFamide-related peptide | 22860213#Jiang X, Chen R, Wang J, Metzler A, Tlusty M, Li L#Mass spectral charting of neuropeptidomic expression in the stomatogastric ganglion at multiple developmental stages of the lobster Homarus americanus#ACS Chem Neurosci 2012 Jun 20;3(6):439-50 | |
NP01502 | SPKNFLRF |
8 | Homarus americanus | FMRFamide related peptide | FMRFamide-related peptide | 20025296#Chen R, Jiang X, Conaway MC, Mohtashemi I, Hui L, Viner R, Li L#Mass spectral analysis of neuropeptide expression and distribution in the nervous system of the lobster Homarus americanus#J Proteome Res 2010 Feb 5;9(2):818-32 | |
NP01503 | YSDRNYLRF |
9 | Homarus americanus | FMRFamide related peptide | FMRFamide-related peptide | 20025296#Chen R, Jiang X, Conaway MC, Mohtashemi I, Hui L, Viner R, Li L#Mass spectral analysis of neuropeptide expression and distribution in the nervous system of the lobster Homarus americanus#J Proteome Res 2010 Feb 5;9(2):818-32 | |
NP01504 | NRNFLRF |
7 | Homarus americanus | FMRFamide related peptide | RFamide | 18088365#Cape SS, Rehm KJ, Ma M, Marder E, Li L#Mass spectral comparison of the neuropeptide complement of the stomatogastric ganglion and brain in the adult and embryonic lobster, Homarus americanus#J Neurochem 2008 May;105(3):690-702 | |
NP01505 | RKPPFNGSIF |
10 | Homarus americanus | FMRFamide related peptide | SIFamide | 18304551#Ma M, Chen R, Sousa GL, Bors EK, Kwiatkowski MA, Goiney CC, Goy MF, Christie AE, Li L#Mass spectral characterization of peptide transmitters/hormones in the nervous system and neuroendocrine organs of the American lobster Homarus americanus#Gen Comp Endocrinol 2008 Apr 1;156(2):395-409 | |
NP01506 | VYRKPPFNGSIF |
12 | Homarus americanus | FMRFamide related peptide | SIFamide | 22860213#Jiang X, Chen R, Wang J, Metzler A, Tlusty M, Li L#Mass spectral charting of neuropeptidomic expression in the stomatogastric ganglion at multiple developmental stages of the lobster Homarus americanus#ACS Chem Neurosci 2012 Jun 20;3(6):439-50 | |
NP01507 | APERNFLRF |
9 | Litopenaeus vannamei | FMRFamide related peptide | FMRFamide-related peptide | 19852991#Ma M, Gard AL, Xiang F, Wang J, Davoodian N, Lenz PH, Malecha SR, Christie AE, Li L#Combining in silico transcriptome mining and biological mass spectrometry for neuropeptide discovery in the Pacific white shrimp Litopenaeus vannamei#Peptides 2010 Jan;31(1):27-43 | |
NP01508 | DGRNFLRF |
8 | Litopenaeus vannamei | FMRFamide related peptide | FMRFamide-related peptide | 19852991#Ma M, Gard AL, Xiang F, Wang J, Davoodian N, Lenz PH, Malecha SR, Christie AE, Li L#Combining in silico transcriptome mining and biological mass spectrometry for neuropeptide discovery in the Pacific white shrimp Litopenaeus vannamei#Peptides 2010 Jan;31(1):27-43 | |
NP01509 | GYSNKDFVRF |
10 | Litopenaeus vannamei | FMRFamide related peptide | FMRFamide-related peptide | 19852991#Ma M, Gard AL, Xiang F, Wang J, Davoodian N, Lenz PH, Malecha SR, Christie AE, Li L#Combining in silico transcriptome mining and biological mass spectrometry for neuropeptide discovery in the Pacific white shrimp Litopenaeus vannamei#Peptides 2010 Jan;31(1):27-43 | |
NP01510 | GYSNKNFVRF |
10 | Litopenaeus vannamei | FMRFamide related peptide | FMRFamide-related peptide | 19852991#Ma M, Gard AL, Xiang F, Wang J, Davoodian N, Lenz PH, Malecha SR, Christie AE, Li L#Combining in silico transcriptome mining and biological mass spectrometry for neuropeptide discovery in the Pacific white shrimp Litopenaeus vannamei#Peptides 2010 Jan;31(1):27-43 | |
NP01511 | NRNFLRF |
7 | Litopenaeus vannamei | FMRFamide related peptide | FMRFamide-related peptide | 19852991#Ma M, Gard AL, Xiang F, Wang J, Davoodian N, Lenz PH, Malecha SR, Christie AE, Li L#Combining in silico transcriptome mining and biological mass spectrometry for neuropeptide discovery in the Pacific white shrimp Litopenaeus vannamei#Peptides 2010 Jan;31(1):27-43 | |
NP01512 | SENRNFLRF |
9 | Litopenaeus vannamei | FMRFamide related peptide | FMRFamide-related peptide | 19852991#Ma M, Gard AL, Xiang F, Wang J, Davoodian N, Lenz PH, Malecha SR, Christie AE, Li L#Combining in silico transcriptome mining and biological mass spectrometry for neuropeptide discovery in the Pacific white shrimp Litopenaeus vannamei#Peptides 2010 Jan;31(1):27-43 | |
NP01513 | GYRKPPFNGSIF |
12 | Litopenaeus vannamei | FMRFamide related peptide | SIFamide | 19852991#Ma M, Gard AL, Xiang F, Wang J, Davoodian N, Lenz PH, Malecha SR, Christie AE, Li L#Combining in silico transcriptome mining and biological mass spectrometry for neuropeptide discovery in the Pacific white shrimp Litopenaeus vannamei#Peptides 2010 Jan;31(1):27-43 | |
NP01514 | RKPPFNGSIF |
10 | Litopenaeus vannamei | FMRFamide related peptide | SIFamide | 19852991#Ma M, Gard AL, Xiang F, Wang J, Davoodian N, Lenz PH, Malecha SR, Christie AE, Li L#Combining in silico transcriptome mining and biological mass spectrometry for neuropeptide discovery in the Pacific white shrimp Litopenaeus vannamei#Peptides 2010 Jan;31(1):27-43 | |
NP01515 | APSQDFMRF |
9 | Lucilia cuprina | FMRFamide related peptide | FMRFa-13 | 23280433#Rahman MM, Neupert S, Predel R#Neuropeptidomics of the Australian sheep blowfly Lucilia cuprina (Wiedemann) and related Diptera#Peptides 2013 Mar;41:31-7 | |
NP01516 | TPPQPSDNFIRF |
12 | Lucilia cuprina | FMRFamide related peptide | FMRFamide-18 | 23280433#Rahman MM, Neupert S, Predel R#Neuropeptidomics of the Australian sheep blowfly Lucilia cuprina (Wiedemann) and related Diptera#Peptides 2013 Mar;41:31-7 | |
NP01517 | AYRKPPFNGSIF |
12 | Lucilia cuprina | FMRFamide related peptide | SIFamide | 23280433#Rahman MM, Neupert S, Predel R#Neuropeptidomics of the Australian sheep blowfly Lucilia cuprina (Wiedemann) and related Diptera#Peptides 2013 Mar;41:31-7 | |
NP01518 | NTLFRF |
6 | Lymnaea stagnalis | FMRFamide related peptide | FRF1 | 15715658#Hoek RM, Li KW, van Minnen J, Lodder JC, de Jong-Brink M, Smit AB, van Kesteren RE#LFRFamides: a novel family of parasitation-induced -RFamide neuropeptides that inhibit the activity of neuroendocrine cells in Lymnaea stagnalis#J Neurochem 2005 Mar;92(5):1073-80 | |
NP01519 | QGSLFRF |
7 | Lymnaea stagnalis | FMRFamide related peptide | FRF2 | 15715658#Hoek RM, Li KW, van Minnen J, Lodder JC, de Jong-Brink M, Smit AB, van Kesteren RE#LFRFamides: a novel family of parasitation-induced -RFamide neuropeptides that inhibit the activity of neuroendocrine cells in Lymnaea stagnalis#J Neurochem 2005 Mar;92(5):1073-80 | |
NP01520 | GGSLFRF |
7 | Lymnaea stagnalis | FMRFamide related peptide | FRF3/5 | 15715658#Hoek RM, Li KW, van Minnen J, Lodder JC, de Jong-Brink M, Smit AB, van Kesteren RE#LFRFamides: a novel family of parasitation-induced -RFamide neuropeptides that inhibit the activity of neuroendocrine cells in Lymnaea stagnalis#J Neurochem 2005 Mar;92(5):1073-80 | |
NP01521 | GTLLRF |
6 | Lymnaea stagnalis | FMRFamide related peptide | FRF4 | 15715658#Hoek RM, Li KW, van Minnen J, Lodder JC, de Jong-Brink M, Smit AB, van Kesteren RE#LFRFamides: a novel family of parasitation-induced -RFamide neuropeptides that inhibit the activity of neuroendocrine cells in Lymnaea stagnalis#J Neurochem 2005 Mar;92(5):1073-80 | |
NP01522 | TLFRF |
5 | Lymnaea stagnalis | FMRFamide related peptide | FRF6 | 15715658#Hoek RM, Li KW, van Minnen J, Lodder JC, de Jong-Brink M, Smit AB, van Kesteren RE#LFRFamides: a novel family of parasitation-induced -RFamide neuropeptides that inhibit the activity of neuroendocrine cells in Lymnaea stagnalis#J Neurochem 2005 Mar;92(5):1073-80 | |
NP01523 | EDVVHSFLRF |
10 | Manduca sexta | FMRFamide related peptide | FLRFamide I | 14599724#Audsley N, Weaver RJ#A comparison of the neuropeptides from the retrocerebral complex of adult male and female Manduca sexta using MALDI-TOF mass spectrometry#Regul Pept 2003 Nov 15;116(1-3):127-37 | |
NP01524 | GNSFLRF |
7 | Manduca sexta | FMRFamide related peptide | FLRFamide II | 14599724#Audsley N, Weaver RJ#A comparison of the neuropeptides from the retrocerebral complex of adult male and female Manduca sexta using MALDI-TOF mass spectrometry#Regul Pept 2003 Nov 15;116(1-3):127-37 | |
NP01525 | DPSFLRF |
7 | Manduca sexta | FMRFamide related peptide | FLRFamide III | 14599724#Audsley N, Weaver RJ#A comparison of the neuropeptides from the retrocerebral complex of adult male and female Manduca sexta using MALDI-TOF mass spectrometry#Regul Pept 2003 Nov 15;116(1-3):127-37 | |
NP01526 | SSIQSLLNLPQRF |
13 | NA | FMRFamide related peptide | Gonadotropin inhibitory hormone-related peptide 2 | 22045661#Ubuka T, Inoue K, Fukuda Y, Mizuno T, Ukena K, Kriegsfeld LJ, Tsutsui K#Identification, expression, and physiological functions of Siberian hamster gonadotropin-inhibitory hormone#Endocrinology 2012 Jan;153(1):373-85 | |
NP01527 | SIKPFANLPLRF |
12 | NA | FMRFamide related peptide | Gonadotropin-inhibitory hormone | 22045661#Ubuka T, Inoue K, Fukuda Y, Mizuno T, Ukena K, Kriegsfeld LJ, Tsutsui K#Identification, expression, and physiological functions of Siberian hamster gonadotropin-inhibitory hormone#Endocrinology 2012 Jan;153(1):373-85 | |
NP01528 | AMAHLPLRLGKNREDSLSRWVPNLPQRF |
28 | NA | FMRFamide related peptide | RFamide-related peptide-3 | 22045661#Ubuka T, Inoue K, Fukuda Y, Mizuno T, Ukena K, Kriegsfeld LJ, Tsutsui K#Identification, expression, and physiological functions of Siberian hamster gonadotropin-inhibitory hormone#Endocrinology 2012 Jan;153(1):373-85 | |
NP01529 | SGRNMEVSLVRQVLNLPQRF |
20 | NA | FMRFamide related peptide | RFamide-related peptide-3 | 22045661#Ubuka T, Inoue K, Fukuda Y, Mizuno T, Ukena K, Kriegsfeld LJ, Tsutsui K#Identification, expression, and physiological functions of Siberian hamster gonadotropin-inhibitory hormone#Endocrinology 2012 Jan;153(1):373-85 | |
NP01530 | AYRKPPFNGSIF |
12 | Nasonia vitripennis | FMRFamide related peptide | SIFamide | 20695486#Hauser F, Neupert S, Williamson M, Predel R, Tanaka Y, Grimmelikhuijzen CJ#Genomics and peptidomics of neuropeptides and protein hormones present in the parasitic wasp Nasonia vitripennis#J Proteome Res 2010 Oct 1;9(10):5296-310 | |
NP01531 | AHKNFLRF |
8 | Ocypode ceratophthalma | FMRFamide related peptide | FLP-extended-FLRFa | 23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34 | |
NP01532 | AHRNFLRF |
8 | Ocypode ceratophthalma | FMRFamide related peptide | FLP-extended-FLRFa | 23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34 | |
NP01533 | APRNFLRF |
8 | Ocypode ceratophthalma | FMRFamide related peptide | FLP-extended-FLRFa | 23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34 | |
NP01534 | AYNQSFLRF |
9 | Ocypode ceratophthalma | FMRFamide related peptide | FLP-extended-FLRFa | 23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34 | |
NP01535 | DENRNFLRF |
9 | Ocypode ceratophthalma | FMRFamide related peptide | FLP-extended-FLRFa | 23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34 | |
NP01536 | DGNRNFLRF |
9 | Ocypode ceratophthalma | FMRFamide related peptide | FLP-extended-FLRFa | 23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34 | |
NP01537 | DRNFLRF |
7 | Ocypode ceratophthalma | FMRFamide related peptide | FLP-extended-FLRFa | 23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34 | |
NP01538 | EFVDPNLRF |
9 | Ocypode ceratophthalma | FMRFamide related peptide | FLP-extended-FLRFa | 23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34 | |
NP01539 | GAHKNYLRF |
9 | Ocypode ceratophthalma | FMRFamide related peptide | FLP-extended-FLRFa | 23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34 | |
NP01540 | GDRNFLRF |
8 | Ocypode ceratophthalma | FMRFamide related peptide | FLP-extended-FLRFa | 23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34 | |
NP01541 | GNRNFLRF |
8 | Ocypode ceratophthalma | FMRFamide related peptide | FLP-extended-FLRFa | 23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34 | |
NP01542 | GRNFLRF |
7 | Ocypode ceratophthalma | FMRFamide related peptide | FLP-extended-FLRFa | 23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34 | |
NP01543 | GRPNFLRF |
8 | Ocypode ceratophthalma | FMRFamide related peptide | FLP-extended-FLRFa | 23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34 | |
NP01544 | NFLRF |
5 | Ocypode ceratophthalma | FMRFamide related peptide | FLP-extended-FLRFa | 23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34 | |
NP01545 | NPSDFLRF |
8 | Ocypode ceratophthalma | FMRFamide related peptide | FLP-extended-FLRFa | 23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34 | |
NP01546 | NQPGVNFL |
8 | Ocypode ceratophthalma | FMRFamide related peptide | FLP-extended-FLRFa | 23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34 | |
NP01547 | NRNFLRF |
7 | Ocypode ceratophthalma | FMRFamide related peptide | FLP-extended-FLRFa | 23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34 | |
NP01548 | NRSNLRF |
7 | Ocypode ceratophthalma | FMRFamide related peptide | FLP-extended-FLRFa | 23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34 | |
NP01549 | PKSNFLRF |
8 | Ocypode ceratophthalma | FMRFamide related peptide | FLP-extended-FLRFa | 23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34 | |
NP01550 | RDRNFLRF |
8 | Ocypode ceratophthalma | FMRFamide related peptide | FLP-extended-FLRFa | 23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34 | |
NP01551 | SKNYLRF |
7 | Ocypode ceratophthalma | FMRFamide related peptide | FLP-extended-FLRFa | 23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34 | |
NP01552 | SVGNRNFLRF |
10 | Ocypode ceratophthalma | FMRFamide related peptide | FLP-extended-FLRFa | 23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34 | |
NP01553 | TNYGGFLRF |
9 | Ocypode ceratophthalma | FMRFamide related peptide | FLP-extended-FLRFa | 23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34 | |
NP01554 | YGNKNYLRF |
9 | Ocypode ceratophthalma | FMRFamide related peptide | FLP-extended-FLRFa | 23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34 | |
NP01555 | GYRKPPFNOSIF |
12 | Ocypode ceratophthalma | FMRFamide related peptide | SIFamide | 23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34 | |
NP01556 | RKPPFNGSIF |
10 | Ocypode ceratophthalma | FMRFamide related peptide | SIFamide | 23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34 | |
NP01557 | ESVLHQPQRF |
10 | Oryzias latipes | FMRFamide related peptide | Neuropeptide FF | 19118555#Suehiro Y, Yasuda A, Okuyama T, Imada H, Kuroyanagi Y, Kubo T, Takeuchi H#Mass spectrometric map of neuropeptide expression and analysis of the gamma-prepro-tachykinin gene expression in the medaka (Oryzias latipes) brain#Gen Comp Endocrinol 2009 Mar;161(1):138-45 | |
NP01558 | GYRKPPFNGS |
10 | Penaeus monodon | FMRFamide related peptide | SIFamide | 21459120#Chansela P, Goto-Inoue N, Zaima N, Sroyraya M, Sobhon P, Setou M#Visualization of neuropeptides in paraffin-embedded tissue sections of the central nervous system in the decapod crustacean, Penaeus monodon, by imaging mass spectrometry#Peptides 2012 Mar;34(1):10-8 | |
NP01559 | RKPPFNGSIF |
10 | Penaeus monodon | FMRFamide related peptide | SIFamide | 21459120#Chansela P, Goto-Inoue N, Zaima N, Sroyraya M, Sobhon P, Setou M#Visualization of neuropeptides in paraffin-embedded tissue sections of the central nervous system in the decapod crustacean, Penaeus monodon, by imaging mass spectrometry#Peptides 2012 Mar;34(1):10-8 | |
NP01560 | QTEDDDKFVRLS |
12 | Periplaneta americana | FMRFamide related peptide | Pea-FMRFa-19 | 15355317#Predel R, Neupert S, Wicher D, Gundel M, Roth S, Derst C#Unique accumulation of neuropeptides in an insect: FMRFamide-related peptides in the cockroach, Periplaneta americana#Eur J Neurosci 2004 Sep;20(6):1499-513 | |
NP01561 | SANQDFMRF |
9 | Sarcophaga bullata | FMRFamide related peptide | Neb-FMRFamide-4 | 15033466#Verleyen P, Huybrechts J, Sas F, Clynen E, Baggerman G, De Loof A, Schoofs L#Neuropeptidomics of the grey flesh fly, Neobellieria bullata#Biochem Biophys Res Commun 2004 Apr 9;316(3):763-70 | |
NP01562 | EEDFMRF |
7 | Sarcophaga bullata | FMRFamide related peptide | Neb-FMRFamide-7 | 15033466#Verleyen P, Huybrechts J, Sas F, Clynen E, Baggerman G, De Loof A, Schoofs L#Neuropeptidomics of the grey flesh fly, Neobellieria bullata#Biochem Biophys Res Commun 2004 Apr 9;316(3):763-70 | |
NP01563 | GGKMFMRF |
8 | Sarcophaga bullata | FMRFamide related peptide | Neb-FMRFamide-7 | 15033466#Verleyen P, Huybrechts J, Sas F, Clynen E, Baggerman G, De Loof A, Schoofs L#Neuropeptidomics of the grey flesh fly, Neobellieria bullata#Biochem Biophys Res Commun 2004 Apr 9;316(3):763-70 | |
NP01564 | AGQDNFMRF |
9 | Sarcophaga bullata | FMRFamide related peptide | Neb-FMRFamide-8 | 15033466#Verleyen P, Huybrechts J, Sas F, Clynen E, Baggerman G, De Loof A, Schoofs L#Neuropeptidomics of the grey flesh fly, Neobellieria bullata#Biochem Biophys Res Commun 2004 Apr 9;316(3):763-70 | |
NP01565 | AYRKPPFNGSLF |
12 | Sarcophaga bullata | FMRFamide related peptide | Neb-LFamide | 15033466#Verleyen P, Huybrechts J, Sas F, Clynen E, Baggerman G, De Loof A, Schoofs L#Neuropeptidomics of the grey flesh fly, Neobellieria bullata#Biochem Biophys Res Commun 2004 Apr 9;316(3):763-70 | |
NP01566 | SPAPANKVPHSAANLPLRF |
19 | Siberian hamster | FMRFamide related peptide | RFamide-related peptide-1 | 22045661#Ubuka T, Inoue K, Fukuda Y, Mizuno T, Ukena K, Kriegsfeld LJ, Tsutsui K#Identification, expression, and physiological functions of Siberian hamster gonadotropin-inhibitory hormone#Endocrinology 2012 Jan;153(1):373-85 | |
NP01567 | TLSRVPSLPQRF |
12 | Siberian hamster | FMRFamide related peptide | RFamide-related peptide-3 | 22045661#Ubuka T, Inoue K, Fukuda Y, Mizuno T, Ukena K, Kriegsfeld LJ, Tsutsui K#Identification, expression, and physiological functions of Siberian hamster gonadotropin-inhibitory hormone#Endocrinology 2012 Jan;153(1):373-85 | |
NP01568 | SIKPFSNLPLRF |
12 | Taeniopygia guttata | FMRFamide related peptide | Gonadotropin-inhibitory hormone | 22045661#Ubuka T, Inoue K, Fukuda Y, Mizuno T, Ukena K, Kriegsfeld LJ, Tsutsui K#Identification, expression, and physiological functions of Siberian hamster gonadotropin-inhibitory hormone#Endocrinology 2012 Jan;153(1):373-85 | |
NP01569 | FMRF |
4 | Alitta virens | FMRFamide related peptide | FMRFamide | 2342992#Krajniak K.G., Price D.A.; #Authentic FMRFamide is present in the polychaete Nereis virens.; #Peptides 11:75-77(1990). | |
NP01570 | QGRF |
4 | Anthopleura elegantissima | FMRFamide related peptide | Antho-RFamide | 2879288#Grimmelikhuijzen C.J.P., Graff D.; #Isolation of pyroGlu-Gly-Arg-Phe-NH2 (Antho-RFamide), a neuropeptide from sea anemones.; #Proc. Natl. Acad. Sci. U.S.A. 83:9817-9821(1986). | |
NP01571 | FLRF |
4 | Aplysia californica | FMRFamide related peptide | FLRF-amide | ||
NP01572 | FMRF |
4 | Aplysia californica | FMRFamide related peptide | FMRF-amide | ||
NP01573 | RYIRF |
5 | Arthurdendyus triangulatus | FMRFamide related peptide | FMRFamide-like neuropeptide RYIRF-amide | 7909164#Maule A.G., Shaw C., Halton D.W., Curry W.J., Thim L.; #RYIRFamide: a turbellarian FMRFamide-related peptide (FaRP).; #Regul. Pept. 50:37-43(1994). | |
NP01574 | KNEFIRF |
7 | Ascaris suum | FMRFamide related peptide | Neuropeptide AF1 | 2627377#Cowden C., Stretton A.O.W., Davis R.E.; #AF1, a sequenced bioactive neuropeptide isolated from the nematode Ascaris suum.; #Neuron 2:1465-1473(1989). | |
NP01575 | KHEYLRF |
7 | Ascaris suum | FMRFamide related peptide | Neuropeptide AF2 | 8332542#Cowden C., Stretton A.O.W.; #AF2, an Ascaris neuropeptide: isolation, sequence, and bioactivity.; #Peptides 14:423-430(1993). | |
NP01576 | SGKPTFIRF |
9 | Ascaris suum | FMRFamide related peptide | FMRFamide-like neuropeptide AF5 | 7651904#Cowden C., Stretton A.O.W.; #Eight novel FMRFamide-like neuropeptides isolated from the nematode Ascaris suum.; #Peptides 16:491-500(1995). | |
NP01577 | AGPRFIRF |
8 | Ascaris suum | FMRFamide related peptide | FMRFamide-like neuropeptide AF7 | 7651904#Cowden C., Stretton A.O.W.; #Eight novel FMRFamide-like neuropeptides isolated from the nematode Ascaris suum.; #Peptides 16:491-500(1995). | |
NP01578 | GLGPRPLRF |
9 | Ascaris suum | FMRFamide related peptide | Neuropeptide AF9 | 7651904#Cowden C., Stretton A.O.W.; #Eight novel FMRFamide-like neuropeptides isolated from the nematode Ascaris suum.; #Peptides 16:491-500(1995). | |
NP01579 | SDIGISEPNFLRF |
13 | Ascaris suum | FMRFamide related peptide | Neuropeptide AF11 | 7651904#Cowden C., Stretton A.O.W.; #Eight novel FMRFamide-like neuropeptides isolated from the nematode Ascaris suum.; #Peptides 16:491-500(1995). | |
NP01580 | GFGDEMSMPGVLRF |
14 | Ascaris suum | FMRFamide related peptide | Neuropeptide AF10 | 7651904#Cowden C., Stretton A.O.W.; #Eight novel FMRFamide-like neuropeptides isolated from the nematode Ascaris suum.; #Peptides 16:491-500(1995). | |
NP01581 | SDMPGVLRF |
9 | Ascaris suum | FMRFamide related peptide | Neuropeptide AF13 | ||
NP01582 | SMPGVLRF |
8 | Ascaris suum | FMRFamide related peptide | Neuropeptide AF14 | ||
NP01583 | GMPGVLRF |
8 | Ascaris suum | FMRFamide related peptide | Neuropeptide AF20 | ||
NP01584 | AVPGVLRF |
8 | Ascaris suum | FMRFamide related peptide | Neuropeptide AF3 | 7651904#Cowden C., Stretton A.O.W.; #Eight novel FMRFamide-like neuropeptides isolated from the nematode Ascaris suum.; #Peptides 16:491-500(1995). | |
NP01585 | GDVPGVLRF |
9 | Ascaris suum | FMRFamide related peptide | Neuropeptide AF4 | 7651904#Cowden C., Stretton A.O.W.; #Eight novel FMRFamide-like neuropeptides isolated from the nematode Ascaris suum.; #Peptides 16:491-500(1995). | |
NP01586 | AQSFLRL |
7 | Austrophasma gansbaaiense | FMRFamide related peptide | Extended FMRFamide-1 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
NP01587 | PAPETNYLRDP |
11 | Austrophasma gansbaaiense | FMRFamide related peptide | Extended FMRFamide-10 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
NP01588 | SPALDDEHNDNFLRF |
15 | Austrophasma gansbaaiense | FMRFamide related peptide | Extended FMRFamide-12 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
NP01589 | PDYLQLARA |
9 | Austrophasma gansbaaiense | FMRFamide related peptide | Extended FMRFamide-2 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
NP01590 | GPDSTFLRL |
9 | Austrophasma gansbaaiense | FMRFamide related peptide | Extended FMRFamide-3 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
NP01591 | GVDSSFLRL |
9 | Austrophasma gansbaaiense | FMRFamide related peptide | Extended FMRFamide-4 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
NP01592 | TDRNFLRL |
8 | Austrophasma gansbaaiense | FMRFamide related peptide | Extended FMRFamide-5 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
NP01593 | ARSDNFVRL |
9 | Austrophasma gansbaaiense | FMRFamide related peptide | Extended FMRFamide-7 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
NP01594 | ARTDNFVRL |
9 | Austrophasma gansbaaiense | FMRFamide related peptide | Extended FMRFamide-8 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
NP01595 | GRGGASNYVRL |
11 | Austrophasma gansbaaiense | FMRFamide related peptide | Extended FMRFamide-9 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
NP01596 | AQSFLRL |
7 | Austrophasma rawsonvillense | FMRFamide related peptide | Extended FMRFamide-1 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
NP01597 | PAPESGFIRDP |
11 | Austrophasma rawsonvillense | FMRFamide related peptide | Extended FMRFamide-10 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
NP01598 | SPTLDDEHNDNFVRL |
15 | Austrophasma rawsonvillense | FMRFamide related peptide | Extended FMRFamide-12 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
NP01599 | SDYLQLAR |
8 | Austrophasma rawsonvillense | FMRFamide related peptide | Extended FMRFamide-2 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
NP01600 | GPDSSFLRL |
9 | Austrophasma rawsonvillense | FMRFamide related peptide | Extended FMRFamide-3 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
NP01601 | GVDSSFLRL |
9 | Austrophasma rawsonvillense | FMRFamide related peptide | Extended FMRFamide-4 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
NP01602 | TDRNFLRL |
8 | Austrophasma rawsonvillense | FMRFamide related peptide | Extended FMRFamide-5 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
NP01603 | ARSDNFVRL |
9 | Austrophasma rawsonvillense | FMRFamide related peptide | Extended FMRFamide-7 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
NP01604 | ARTDNFVRL |
9 | Austrophasma rawsonvillense | FMRFamide related peptide | Extended FMRFamide-8 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
NP01605 | GRGGASNYVRL |
11 | Austrophasma rawsonvillense | FMRFamide related peptide | Extended FMRFamide-9 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
NP01606 | ARNHFIRL |
8 | Bombyx mori | FMRFamide related peptide | ARNHFIRL-amide | 16707581#Yamanaka N., Zitnan D., Kim Y.J., Adams M.E., Hua Y.J., Suzuki Y., Suzuki M., Suzuki A., Satake H., Mizoguchi A., Asaoka K., Tanaka Y., Kataoka H.; #Regulation of insect steroid hormone biosynthesis by innervating peptidergic neurons.; #Proc. Natl. Acad. Sci. U.S.A. 103:8622-8627(2006). | |
NP01607 | DPSFIRF |
7 | Bombyx mori | FMRFamide related peptide | DPSFIRF-amide | 16707581#Yamanaka N., Zitnan D., Kim Y.J., Adams M.E., Hua Y.J., Suzuki Y., Suzuki M., Suzuki A., Satake H., Mizoguchi A., Asaoka K., Tanaka Y., Kataoka H.; #Regulation of insect steroid hormone biosynthesis by innervating peptidergic neurons.; #Proc. Natl. Acad. Sci. U.S.A. 103:8622-8627(2006). | |
NP01608 | SAIDRSMIRF |
10 | Bombyx mori | FMRFamide related peptide | SAIDRSMIRF-amide | 16707581#Yamanaka N., Zitnan D., Kim Y.J., Adams M.E., Hua Y.J., Suzuki Y., Suzuki M., Suzuki A., Satake H., Mizoguchi A., Asaoka K., Tanaka Y., Kataoka H.; #Regulation of insect steroid hormone biosynthesis by innervating peptidergic neurons.; #Proc. Natl. Acad. Sci. U.S.A. 103:8622-8627(2006). | |
NP01609 | SASFVRF |
7 | Bombyx mori | FMRFamide related peptide | SASFVRF-amide | 16707581#Yamanaka N., Zitnan D., Kim Y.J., Adams M.E., Hua Y.J., Suzuki Y., Suzuki M., Suzuki A., Satake H., Mizoguchi A., Asaoka K., Tanaka Y., Kataoka H.; #Regulation of insect steroid hormone biosynthesis by innervating peptidergic neurons.; #Proc. Natl. Acad. Sci. U.S.A. 103:8622-8627(2006). | |
NP01610 | AGEGLSSPFWSLAAPQRF |
18 | Bos taurus | FMRFamide related peptide | Neuropeptide AF | ||
NP01611 | FLFQPQRF |
8 | Bos taurus | FMRFamide related peptide | Neuropeptide FF | ||
NP01612 | SPAFLFQPQRF |
11 | Bos taurus | FMRFamide related peptide | Neuropeptide SF | ||
NP01613 | SLTFEEVKDWAPKIKMNKPVVNKMPPSAANLPLRF |
35 | Bos taurus | FMRFamide related peptide | Neuropeptide NPSF | 11583817#Fukusumi S., Habata Y., Yoshida H., Iijima N., Kawamata Y., Hosoya M., Fujii R., Hinuma S., Kitada C., Shintani Y., Suenaga M., Onda H., Nishimura O., Tanaka M., Ibata Y., Fujino M.; #Characteristics and distribution of endogenous RFamide-related peptide-1.; #Biochim. Biophys. Acta 1540:221-232(2001). | |
NP01614 | WVPNLPQRF |
9 | Bos taurus | FMRFamide related peptide | Neuropeptide NPVF (By similarity) | ||
NP01615 | MPPSAANLPLRF |
12 | Bos taurus | FMRFamide related peptide | Neuropeptide RFRP-1 (Potential) | ||
NP01616 | STRAMAHLPLRL |
12 | Bos taurus | FMRFamide related peptide | Neuropeptide RFRP-2 (Potential) | ||
NP01617 | AQTFVRF |
7 | Caenorhabditis briggsae | FMRFamide related peptide | AQTFVRF-amide 1 (By similarity) | ||
NP01618 | GQTFVRF |
7 | Caenorhabditis briggsae | FMRFamide related peptide | GQTFVRF-amide (By similarity) | ||
NP01619 | VPSAGDMMVRF |
11 | Caenorhabditis briggsae | FMRFamide related peptide | Neuropeptide AF 36 | ||
NP01620 | EASAFGDIIGELKGKGLGGRMRF |
23 | Caenorhabditis briggsae | FMRFamide related peptide | EASAFGDIIGELKGKGLGGRMRF-amide (Bysimilarity) | ||
NP01621 | AAADPNFLRF |
10 | Caenorhabditis elegans | FMRFamide related peptide | AAADPNFLRF-amide | 8483810# Rosoff M.L., Doble K.E., Price D.A., Li C.; #The flp-1 propeptide is processed into multiple, highly similar FMRFamide-like peptides in Caenorhabditis elegans.; # Peptides 14:331-338(1993).$16061202#Husson S.J., Clynen E., Baggerman G., De Loof A., Schoofs L.; #Discovering neuropeptides in Caenorhabditis elegans by two dimensional liquid chromatography and mass spectrometry.; #Biochem. Biophys. Res. Commun. 335:76-86(2005). | |
NP01622 | AGSDPNFLRF |
10 | Caenorhabditis elegans | FMRFamide related peptide | AGSDPNFLRF-amide | 8483810#Rosoff M.L., Doble K.E., Price D.A., Li C.; #The flp-1 propeptide is processed into multiple, highly similar FMRFamide-like peptides in Caenorhabditis elegans.; #Peptides 14:331-338(1993). | |
NP01623 | ASGDPNFLRF |
10 | Caenorhabditis elegans | FMRFamide related peptide | ASGDPNFLRF-amide | 8483810#Rosoff M.L., Doble K.E., Price D.A., Li C.; #The flp-1 propeptide is processed into multiple, highly similar FMRFamide-like peptides in Caenorhabditis elegans.; #Peptides 14:331-338(1993). | |
NP01624 | SDPNFLRF |
8 | Caenorhabditis elegans | FMRFamide related peptide | Neuropeptide PF1 | 8483810#Rosoff M.L., Doble K.E., Price D.A., Li C.; #The flp-1 propeptide is processed into multiple, highly similar FMRFamide-like peptides in Caenorhabditis elegans.; #Peptides 14:331-338(1993). | |
NP01625 | PNFLRF |
6 | Caenorhabditis elegans | FMRFamide related peptide | PNFLRF-amide | 8483810#Rosoff M.L., Doble K.E., Price D.A., Li C.; #The flp-1 propeptide is processed into multiple, highly similar FMRFamide-like peptides in Caenorhabditis elegans.; #Peptides 14:331-338(1993). | |
NP01626 | PNFMRY |
6 | Caenorhabditis elegans | FMRFamide related peptide | PNFMRY-amide | 8483810#Rosoff M.L., Doble K.E., Price D.A., Li C.; #The flp-1 propeptide is processed into multiple, highly similar FMRFamide-like peptides in Caenorhabditis elegans.; #Peptides 14:331-338(1993). | |
NP01627 | SADPNFLRF |
9 | Caenorhabditis elegans | FMRFamide related peptide | SADPNFLRF-amide | 8483810# Rosoff M.L., Doble K.E., Price D.A., Li C.; #The flp-1 propeptide is processed into multiple, highly similar FMRFamide-like peptides in Caenorhabditis elegans.; # Peptides 14:331-338(1993).$16061202#Husson S.J., Clynen E., Baggerman G., De Loof A., Schoofs L.; #Discovering neuropeptides in Caenorhabditis elegans by two dimensional liquid chromatography and mass spectrometry.; #Biochem. Biophys. Res. Commun. 335:76-86(2005). | |
NP01628 | SQPNFLRF |
8 | Caenorhabditis elegans | FMRFamide related peptide | SQPNFLRF-amide | 8483810#Rosoff M.L., Doble K.E., Price D.A., Li C.; #The flp-1 propeptide is processed into multiple, highly similar FMRFamide-like peptides in Caenorhabditis elegans.; #Peptides 14:331-338(1993). | |
NP01629 | ASEDALFGTMRF |
12 | Caenorhabditis elegans | FMRFamide related peptide | ASEDALFGTMRF-amide | 16061202#Husson S.J., Clynen E., Baggerman G., De Loof A., Schoofs L.; #Discovering neuropeptides in Caenorhabditis elegans by two dimensional liquid chromatography and mass spectrometry.; #Biochem. Biophys. Res. Commun. 335:76-86(2005). | |
NP01630 | EAEEPLGTMRF |
11 | Caenorhabditis elegans | FMRFamide related peptide | EAEEPLGTMRF-amide | 16061202#Husson S.J., Clynen E., Baggerman G., De Loof A., Schoofs L.; #Discovering neuropeptides in Caenorhabditis elegans by two dimensional liquid chromatography and mass spectrometry.; #Biochem. Biophys. Res. Commun. 335:76-86(2005). | |
NP01631 | NPENDTPFGTMRF |
13 | Caenorhabditis elegans | FMRFamide related peptide | NPENDTPFGTMRF-amide | 16061202#Husson S.J., Clynen E., Baggerman G., De Loof A., Schoofs L.; #Discovering neuropeptides in Caenorhabditis elegans by two dimensional liquid chromatography and mass spectrometry.; #Biochem. Biophys. Res. Commun. 335:76-86(2005). | |
NP01632 | NPLGTMRF |
8 | Caenorhabditis elegans | FMRFamide related peptide | NPLGTMRF-amide (Potential) | ||
NP01633 | SADDSAPFGTMRF |
13 | Caenorhabditis elegans | FMRFamide related peptide | SADDSAPFGTMRF-amide | 16061202#Husson S.J., Clynen E., Baggerman G., De Loof A., Schoofs L.; #Discovering neuropeptides in Caenorhabditis elegans by two dimensional liquid chromatography and mass spectrometry.; #Biochem. Biophys. Res. Commun. 335:76-86(2005). | |
NP01634 | SAEPFGTMRF |
10 | Caenorhabditis elegans | FMRFamide related peptide | SAEPFGTMRF-amide | 16061202#Husson S.J., Clynen E., Baggerman G., De Loof A., Schoofs L.; #Discovering neuropeptides in Caenorhabditis elegans by two dimensional liquid chromatography and mass spectrometry.; #Biochem. Biophys. Res. Commun. 335:76-86(2005). | |
NP01635 | SPLGTMRF |
8 | Caenorhabditis elegans | FMRFamide related peptide | SPLGTMRF-amide (Potential) | ||
NP01636 | TPLGTMRF |
8 | Caenorhabditis elegans | FMRFamide related peptide | TPLGTMRF-amide | 16061202#Husson S.J., Clynen E., Baggerman G., De Loof A., Schoofs L.; #Discovering neuropeptides in Caenorhabditis elegans by two dimensional liquid chromatography and mass spectrometry.; #Biochem. Biophys. Res. Commun. 335:76-86(2005). | |
NP01637 | AGAKFIRF |
8 | Caenorhabditis elegans | FMRFamide related peptide | AGAKFIRF-amide | ||
NP01638 | APKPKFIRF |
9 | Caenorhabditis elegans | FMRFamide related peptide | APKPKFIRF-amide (Potential) | ||
NP01639 | GAKFIRF |
7 | Caenorhabditis elegans | FMRFamide related peptide | GAKFIRF-amide | 16061202#Husson S.J., Clynen E., Baggerman G., De Loof A., Schoofs L.; #Discovering neuropeptides in Caenorhabditis elegans by two dimensional liquid chromatography and mass spectrometry.; #Biochem. Biophys. Res. Commun. 335:76-86(2005). | |
NP01640 | KSAYMRF |
7 | Caenorhabditis elegans | FMRFamide related peptide | KSAYMRF-amide 1 | 9675153#Marks N.J., Maule A.G., Geary T.G., Thompson D.P., Li C., Halton D.W., Shaw C.; #KSAYMRFamide (PF3/AF8) is present in the free-living nematode, Caenorhabditis elegans.; #Biochem. Biophys. Res. Commun. 248:422-425(1998). | |
NP01641 | QQDSEVEREMM |
11 | Caenorhabditis elegans | FMRFamide related peptide | QQDSEVEREMM | 16061202#Husson S.J., Clynen E., Baggerman G., De Loof A., Schoofs L.; #Discovering neuropeptides in Caenorhabditis elegans by two dimensional liquid chromatography and mass spectrometry.; #Biochem. Biophys. Res. Commun. 335:76-86(2005). | |
NP01642 | KPSFVRF |
7 | Caenorhabditis elegans | FMRFamide related peptide | KPSFVRF-amide 1 | 9920762# Marks N.J., Maule A.G., Li C., Nelson L.S., Thompson D.P., Alexander-Bowman S., Geary T.G., Halton D.W., Verhaert P., Shaw C.; #Isolation, pharmacology and gene organization of KPSFVRFamide: a neuropeptide from Caenorhabditis elegans.; # Biochem. Biophys. Res. Commun. 254:222-230(1999).$16061202#Husson S.J., Clynen E., Baggerman G., De Loof A., Schoofs L.; #Discovering neuropeptides in Caenorhabditis elegans by two dimensional liquid chromatography and mass spectrometry.; #Biochem. Biophys. Res. Commun. 335:76-86(2005). | |
NP01643 | AMRNALVRF |
9 | Caenorhabditis elegans | FMRFamide related peptide | AMRNALVRF-amide (Potential) | ||
NP01644 | ASGGMRNALVRF |
12 | Caenorhabditis elegans | FMRFamide related peptide | ASGGMRNALVRF-amide | 16061202#Husson S.J., Clynen E., Baggerman G., De Loof A., Schoofs L.; #Discovering neuropeptides in Caenorhabditis elegans by two dimensional liquid chromatography and mass spectrometry.; #Biochem. Biophys. Res. Commun. 335:76-86(2005). | |
NP01645 | NGAPQPFVRF |
10 | Caenorhabditis elegans | FMRFamide related peptide | Neuropeptide AF22 | 16061202#Husson S.J., Clynen E., Baggerman G., De Loof A., Schoofs L.; #Discovering neuropeptides in Caenorhabditis elegans by two dimensional liquid chromatography and mass spectrometry.; #Biochem. Biophys. Res. Commun. 335:76-86(2005). | |
NP01646 | SPLDEEDFAPESPLQ |
15 | Caenorhabditis elegans | FMRFamide related peptide | SPLDEEDFAPESPLQ-amide | 16061202#Husson S.J., Clynen E., Baggerman G., De Loof A., Schoofs L.; #Discovering neuropeptides in Caenorhabditis elegans by two dimensional liquid chromatography and mass spectrometry.; #Biochem. Biophys. Res. Commun. 335:76-86(2005). | |
NP01647 | AADGAPLIRF |
10 | Caenorhabditis elegans | FMRFamide related peptide | AADGAPLIRF-amide 1 | 16061202# Husson S.J., Clynen E., Baggerman G., De Loof A., Schoofs L.; #Discovering neuropeptides in Caenorhabditis elegans by two dimensional liquid chromatography and mass spectrometry.; # Biochem. Biophys. Res. Commun. 335:76-86(2005).$11527423#Marks N.J., Shaw C., Halton D.W., Thompson D.P., Geary T.G., Li C., Maule A.G.; #Isolation and preliminary biological assessment of AADGAPLIRFamide and SVPGVLRFamide from Caenorhabditis elegans.; #Biochem. Biophys. Res. Commun. 286:1170-1176(2001). | |
NP01648 | AMDSPLIRF |
9 | Caenorhabditis elegans | FMRFamide related peptide | AMDSPLIRF-amide | 16061202#Husson S.J., Clynen E., Baggerman G., De Loof A., Schoofs L.; #Discovering neuropeptides in Caenorhabditis elegans by two dimensional liquid chromatography and mass spectrometry.; #Biochem. Biophys. Res. Commun. 335:76-86(2005). | |
NP01649 | APEASPFIRF |
10 | Caenorhabditis elegans | FMRFamide related peptide | APEASPFIRF-amide 2 | 16061202# Husson S.J., Clynen E., Baggerman G., De Loof A., Schoofs L.; #Discovering neuropeptides in Caenorhabditis elegans by two dimensional liquid chromatography and mass spectrometry.; # Biochem. Biophys. Res. Commun. 335:76-86(2005).$9070852#Marks N.J., Maule A.G., Geary T.G., Thompson D.P., Davis J.P., Halton D.W., Verhaert P., Shaw C.; #APEASPFIRFamide, a novel FMRFamide-related decapeptide from Caenorhabditis elegans: structure and myoactivity.; #Biochem. Biophys. Res. Commun. 231:591-595(1997). | |
NP01650 | ASPSAPLIRF |
10 | Caenorhabditis elegans | FMRFamide related peptide | ASPSAPLIRF-amide | 16061202#Husson S.J., Clynen E., Baggerman G., De Loof A., Schoofs L.; #Discovering neuropeptides in Caenorhabditis elegans by two dimensional liquid chromatography and mass spectrometry.; #Biochem. Biophys. Res. Commun. 335:76-86(2005). | |
NP01651 | ASSAPLIRF |
9 | Caenorhabditis elegans | FMRFamide related peptide | ASSAPLIRF-amide (Potential) | ||
NP01652 | SAAAPLIRF |
9 | Caenorhabditis elegans | FMRFamide related peptide | SAAAPLIRF-amide | 16061202#Husson S.J., Clynen E., Baggerman G., De Loof A., Schoofs L.; #Discovering neuropeptides in Caenorhabditis elegans by two dimensional liquid chromatography and mass spectrometry.; #Biochem. Biophys. Res. Commun. 335:76-86(2005). | |
NP01653 | SDRPTRAMDSPLIRF |
15 | Caenorhabditis elegans | FMRFamide related peptide | SDRPTRAMDSPLIRF-amide (Potential) | ||
NP01654 | SPSAVPLIRF |
10 | Caenorhabditis elegans | FMRFamide related peptide | SPSAVPLIRF-amide | 16061202#Husson S.J., Clynen E., Baggerman G., De Loof A., Schoofs L.; #Discovering neuropeptides in Caenorhabditis elegans by two dimensional liquid chromatography and mass spectrometry.; #Biochem. Biophys. Res. Commun. 335:76-86(2005). | |
NP01655 | KHEYLRF |
7 | Caenorhabditis elegans | FMRFamide related peptide | Neuropeptide AF2 | 8554607#Marks N.J., Shaw C., Maule A.G., Davis J.P., Halton D.W., Verhaert P., Geary T.G., Thompson D.P.; #Isolation of AF2 (KHEYLRFamide) from Caenorhabditis elegans: evidence for the presence of more than one FMRFamide-related peptide-encoding gene.; #Biochem. Biophys. Res. Commun. 217:845-851(1995). | |
NP01656 | AQTFVRF |
7 | Caenorhabditis elegans | FMRFamide related peptide | AQTFVRF-amide 1 | 16061202#Husson S.J., Clynen E., Baggerman G., De Loof A., Schoofs L.; #Discovering neuropeptides in Caenorhabditis elegans by two dimensional liquid chromatography and mass spectrometry.; #Biochem. Biophys. Res. Commun. 335:76-86(2005). | |
NP01657 | GQTFVRF |
7 | Caenorhabditis elegans | FMRFamide related peptide | GQTFVRF-amide | 16061202#Husson S.J., Clynen E., Baggerman G., De Loof A., Schoofs L.; #Discovering neuropeptides in Caenorhabditis elegans by two dimensional liquid chromatography and mass spectrometry.; #Biochem. Biophys. Res. Commun. 335:76-86(2005). | |
NP01658 | DVPGVLRF |
8 | Caenorhabditis elegans | FMRFamide related peptide | DVPGVLRF-amide | ||
NP01659 | EIPGVLRF |
8 | Caenorhabditis elegans | FMRFamide related peptide | EIPGVLRF-amide | ||
NP01660 | EMPGVLRF |
8 | Caenorhabditis elegans | FMRFamide related peptide | EMPGVLRF-amide | 16187307#Papaioannou S., Marsden D., Franks C.J., Walker R.J., Holden-Dye L.; #Role of a FMRFamide-like family of neuropeptides in the pharyngeal nervous system of Caenorhabditis elegans.; #J. Neurobiol. 65:304-319(2005). | |
NP01661 | SEVPGVLRF |
9 | Caenorhabditis elegans | FMRFamide related peptide | SEVPGVLRF-amide | ||
NP01662 | SVPGVLRF |
8 | Caenorhabditis elegans | FMRFamide related peptide | SVPGVLRF-amide 1 | 11527423#Marks N.J., Shaw C., Halton D.W., Thompson D.P., Geary T.G., Li C., Maule A.G.; #Isolation and preliminary biological assessment of AADGAPLIRFamide and SVPGVLRFamide from Caenorhabditis elegans.; #Biochem. Biophys. Res. Commun. 286:1170-1176(2001). | |
NP01663 | WANQVRF |
7 | Caenorhabditis elegans | FMRFamide related peptide | WANQVRF-amide | 16061202#Husson S.J., Clynen E., Baggerman G., De Loof A., Schoofs L.; #Discovering neuropeptides in Caenorhabditis elegans by two dimensional liquid chromatography and mass spectrometry.; #Biochem. Biophys. Res. Commun. 335:76-86(2005). | |
NP01664 | VVGQQDFLRF |
10 | Caenorhabditis elegans | FMRFamide related peptide | VVGQQDFLRF-amide (Potential) | ||
NP01665 | VPSAGDMMVRF |
11 | Caenorhabditis elegans | FMRFamide related peptide | Neuropeptide AF 36 | 16061202#Husson S.J., Clynen E., Baggerman G., De Loof A., Schoofs L.; #Discovering neuropeptides in Caenorhabditis elegans by two dimensional liquid chromatography and mass spectrometry.; #Biochem. Biophys. Res. Commun. 335:76-86(2005). | |
NP01666 | EFNADDLTLRF |
11 | Caenorhabditis elegans | FMRFamide related peptide | EFNADDLTLRF-amide | 16061202#Husson S.J., Clynen E., Baggerman G., De Loof A., Schoofs L.; #Discovering neuropeptides in Caenorhabditis elegans by two dimensional liquid chromatography and mass spectrometry.; #Biochem. Biophys. Res. Commun. 335:76-86(2005). | |
NP01667 | GGAGEPLAFSPDMLSLRF |
18 | Caenorhabditis elegans | FMRFamide related peptide | GGAGEPLAFSPDMLSLRF-amide | 16061202#Husson S.J., Clynen E., Baggerman G., De Loof A., Schoofs L.; #Discovering neuropeptides in Caenorhabditis elegans by two dimensional liquid chromatography and mass spectrometry.; #Biochem. Biophys. Res. Commun. 335:76-86(2005). | |
NP01668 | EASAFGDIIGELKGKGLGGRMRF |
23 | Caenorhabditis elegans | FMRFamide related peptide | EASAFGDIIGELKGKGLGGRMRF-amide | 19456328#Clynen E., Husson S.J., Schoofs L.; #Identification of new members of the (short) neuropeptide F family in locusts and Caenorhabditis elegans.; #Ann. N. Y. Acad. Sci. 1163:60-74(2009). | |
NP01669 | QGRF |
4 | Calliactis parasitica | FMRFamide related peptide | Antho-RFamide | ||
NP01670 | GYNRSFLRF |
9 | Callinectes sapidus | FMRFamide related peptide | FMRFamide-like neuropeptide | 1815216#Krajniak K.G.; #The identification and structure-activity relations of a cardioactive FMRFamide-related peptide from the blue crab Callinectes sapidus.; #Peptides 12:1295-1302(1991). | |
NP01671 | TPQQDFMRF |
9 | Calliphora vomitoria | FMRFamide related peptide | CalliFMRFamide-1 | 1549595#Duve H., Johnsen A.H., Sewell J.C., Scott A.G., Orchard I., Rehfeld J.F., Thorpe A.; #Isolation, structure, and activity of -Phe-Met-Arg-Phe-NH2 neuropeptides (designated calliFMRFamides) from the blowfly Calliphora vomitoria.; #Proc. Natl. Acad. Sci. U.S.A. 89:2326-2330(1992). | |
NP01672 | TPSQDFMRF |
9 | Calliphora vomitoria | FMRFamide related peptide | CalliFMRFamide-2 | 1549595#Duve H., Johnsen A.H., Sewell J.C., Scott A.G., Orchard I., Rehfeld J.F., Thorpe A.; #Isolation, structure, and activity of -Phe-Met-Arg-Phe-NH2 neuropeptides (designated calliFMRFamides) from the blowfly Calliphora vomitoria.; #Proc. Natl. Acad. Sci. U.S.A. 89:2326-2330(1992). | |
NP01673 | SPSQDFMRF |
9 | Calliphora vomitoria | FMRFamide related peptide | CalliFMRFamide-3 | 1549595#Duve H., Johnsen A.H., Sewell J.C., Scott A.G., Orchard I., Rehfeld J.F., Thorpe A.; #Isolation, structure, and activity of -Phe-Met-Arg-Phe-NH2 neuropeptides (designated calliFMRFamides) from the blowfly Calliphora vomitoria.; #Proc. Natl. Acad. Sci. U.S.A. 89:2326-2330(1992). | |
NP01674 | KPNQDFMRF |
9 | Calliphora vomitoria | FMRFamide related peptide | CalliFMRFamide-4 | 1549595#Duve H., Johnsen A.H., Sewell J.C., Scott A.G., Orchard I., Rehfeld J.F., Thorpe A.; #Isolation, structure, and activity of -Phe-Met-Arg-Phe-NH2 neuropeptides (designated calliFMRFamides) from the blowfly Calliphora vomitoria.; #Proc. Natl. Acad. Sci. U.S.A. 89:2326-2330(1992). | |
NP01675 | APGQDFMRF |
9 | Calliphora vomitoria | FMRFamide related peptide | CalliFMRFamide-5 | 1549595#Duve H., Johnsen A.H., Sewell J.C., Scott A.G., Orchard I., Rehfeld J.F., Thorpe A.; #Isolation, structure, and activity of -Phe-Met-Arg-Phe-NH2 neuropeptides (designated calliFMRFamides) from the blowfly Calliphora vomitoria.; #Proc. Natl. Acad. Sci. U.S.A. 89:2326-2330(1992). | |
NP01676 | ASGQDFMRF |
9 | Calliphora vomitoria | FMRFamide related peptide | CalliFMRFamide-6 | 1549595#Duve H., Johnsen A.H., Sewell J.C., Scott A.G., Orchard I., Rehfeld J.F., Thorpe A.; #Isolation, structure, and activity of -Phe-Met-Arg-Phe-NH2 neuropeptides (designated calliFMRFamides) from the blowfly Calliphora vomitoria.; #Proc. Natl. Acad. Sci. U.S.A. 89:2326-2330(1992). | |
NP01677 | AXGQDFMRF |
9 | Calliphora vomitoria | FMRFamide related peptide | CalliFMRFamide-7 | 1549595#Duve H., Johnsen A.H., Sewell J.C., Scott A.G., Orchard I., Rehfeld J.F., Thorpe A.; #Isolation, structure, and activity of -Phe-Met-Arg-Phe-NH2 neuropeptides (designated calliFMRFamides) from the blowfly Calliphora vomitoria.; #Proc. Natl. Acad. Sci. U.S.A. 89:2326-2330(1992). | |
NP01678 | GANDFMRF |
8 | Calliphora vomitoria | FMRFamide related peptide | CalliFMRFamide-8 | 1549595#Duve H., Johnsen A.H., Sewell J.C., Scott A.G., Orchard I., Rehfeld J.F., Thorpe A.; #Isolation, structure, and activity of -Phe-Met-Arg-Phe-NH2 neuropeptides (designated calliFMRFamides) from the blowfly Calliphora vomitoria.; #Proc. Natl. Acad. Sci. U.S.A. 89:2326-2330(1992). | |
NP01679 | SVNTKNDFMRF |
11 | Calliphora vomitoria | FMRFamide related peptide | CalliFMRFamide-9 | 1549595#Duve H., Johnsen A.H., Sewell J.C., Scott A.G., Orchard I., Rehfeld J.F., Thorpe A.; #Isolation, structure, and activity of -Phe-Met-Arg-Phe-NH2 neuropeptides (designated calliFMRFamides) from the blowfly Calliphora vomitoria.; #Proc. Natl. Acad. Sci. U.S.A. 89:2326-2330(1992). | |
NP01680 | TPNRDFMRF |
9 | Calliphora vomitoria | FMRFamide related peptide | CalliFMRFamide-10 | 1549595#Duve H., Johnsen A.H., Sewell J.C., Scott A.G., Orchard I., Rehfeld J.F., Thorpe A.; #Isolation, structure, and activity of -Phe-Met-Arg-Phe-NH2 neuropeptides (designated calliFMRFamides) from the blowfly Calliphora vomitoria.; #Proc. Natl. Acad. Sci. U.S.A. 89:2326-2330(1992). | |
NP01681 | PDNFMRF |
7 | Calliphora vomitoria | FMRFamide related peptide | CalliFMRFamide-11 | 1549595#Duve H., Johnsen A.H., Sewell J.C., Scott A.G., Orchard I., Rehfeld J.F., Thorpe A.; #Isolation, structure, and activity of -Phe-Met-Arg-Phe-NH2 neuropeptides (designated calliFMRFamides) from the blowfly Calliphora vomitoria.; #Proc. Natl. Acad. Sci. U.S.A. 89:2326-2330(1992). | |
NP01682 | AAGQDNFMRF |
10 | Calliphora vomitoria | FMRFamide related peptide | CalliFMRFamide-12 | 1549595#Duve H., Johnsen A.H., Sewell J.C., Scott A.G., Orchard I., Rehfeld J.F., Thorpe A.; #Isolation, structure, and activity of -Phe-Met-Arg-Phe-NH2 neuropeptides (designated calliFMRFamides) from the blowfly Calliphora vomitoria.; #Proc. Natl. Acad. Sci. U.S.A. 89:2326-2330(1992). | |
NP01683 | AGQDGFMRF |
9 | Calliphora vomitoria | FMRFamide related peptide | CalliFMRFamide-13 | 1549595#Duve H., Johnsen A.H., Sewell J.C., Scott A.G., Orchard I., Rehfeld J.F., Thorpe A.; #Isolation, structure, and activity of -Phe-Met-Arg-Phe-NH2 neuropeptides (designated calliFMRFamides) from the blowfly Calliphora vomitoria.; #Proc. Natl. Acad. Sci. U.S.A. 89:2326-2330(1992). | |
NP01684 | APNQPSDNMIRF |
12 | Calliphora vomitoria | FMRFamide related peptide | CalliMIRFamide-1 | 1549595#Duve H., Johnsen A.H., Sewell J.C., Scott A.G., Orchard I., Rehfeld J.F., Thorpe A.; #Isolation, structure, and activity of -Phe-Met-Arg-Phe-NH2 neuropeptides (designated calliFMRFamides) from the blowfly Calliphora vomitoria.; #Proc. Natl. Acad. Sci. U.S.A. 89:2326-2330(1992). | |
NP01685 | SIKPSAYLPLRF |
12 | Coturnix coturnix japonica | FMRFamide related peptide | Gonadotropin inhibitory hormone | 10964719#Tsutsui K., Saigoh E., Ukena K., Teranishi H., Fujisawa Y., Kikuchi M., Ishii S., Sharp P.J.; #A novel avian hypothalamic peptide inhibiting gonadotropin release.; #Biochem. Biophys. Res. Commun. 275:661-667(2000). | |
NP01686 | VPNSVANLPLRF |
12 | Coturnix coturnix japonica | FMRFamide related peptide | Gonadotropin inhibitory hormone-related peptide 1 | ||
NP01687 | SSIQSLLNLSQRF |
13 | Coturnix coturnix japonica | FMRFamide related peptide | Gonadotropin inhibitory hormone-related peptide 2 | ||
NP01688 | AYRKPPFNGSIF |
12 | Delia radicum | FMRFamide related peptide | SIFamide-related peptide | 22848525#Zoephel J., Reiher W., Rexer K.-H., Kahnt J., Wegener C.; #Peptidomics of the agriculturally damaging larval stage of the cabbage root fly Delia radicum (Diptera: Anthomyiidae).; #PLoS ONE 7:E41543-E41543(2012). | |
NP01689 | GDNFMRF |
7 | Delia radicum | FMRFamide related peptide | FMRFamide-like neuropeptide GDNFMRF-amide | 22848525#Zoephel J., Reiher W., Rexer K.-H., Kahnt J., Wegener C.; #Peptidomics of the agriculturally damaging larval stage of the cabbage root fly Delia radicum (Diptera: Anthomyiidae).; #PLoS ONE 7:E41543-E41543(2012). | |
NP01690 | SAQGQDFMRF |
10 | Delia radicum | FMRFamide related peptide | FMRFamide-like neuropeptide SAQGQDFMRF-amide | 22848525#Zoephel J., Reiher W., Rexer K.-H., Kahnt J., Wegener C.; #Peptidomics of the agriculturally damaging larval stage of the cabbage root fly Delia radicum (Diptera: Anthomyiidae).; #PLoS ONE 7:E41543-E41543(2012). | |
NP01691 | GQDFMRF |
7 | Delia radicum | FMRFamide related peptide | FMRFamide-like neuropeptide GQDFMRF-amide | 22848525#Zoephel J., Reiher W., Rexer K.-H., Kahnt J., Wegener C.; #Peptidomics of the agriculturally damaging larval stage of the cabbage root fly Delia radicum (Diptera: Anthomyiidae).; #PLoS ONE 7:E41543-E41543(2012). | |
NP01692 | PDNFMRF |
7 | Delia radicum | FMRFamide related peptide | FMRFamide-like neuropeptide PDNFMRF-amide | 20869420#Audsley N., Matthews H.J., Down R.E., Weaver R.J.; #Neuropeptides associated with the central nervous system of the cabbage root fly, Delia radicum (L).; #Peptides 32:434-440(2011).$22848525#Zoephel J., Reiher W., Rexer K.-H., Kahnt J., Wegener C.; #"Peptidomics of the agriculturally damaging larval stage of the cabbage root fly Delia radicum (Diptera: Anthomyiidae)."; #PLoS ONE 7:E41543-E41543(2012). | |
NP01693 | GGNDFMRF |
8 | Delia radicum | FMRFamide related peptide | FMRFamide-like neuropeptide GGNDFMRF-amide | 20869420#Audsley N., Matthews H.J., Down R.E., Weaver R.J.; #Neuropeptides associated with the central nervous system of the cabbage root fly, Delia radicum (L).; #Peptides 32:434-440(2011).$22848525#Zoephel J., Reiher W., Rexer K.-H., Kahnt J., Wegener C.; #"Peptidomics of the agriculturally damaging larval stage of the cabbage root fly Delia radicum (Diptera: Anthomyiidae)."; #PLoS ONE 7:E41543-E41543(2012). | |
NP01694 | PGQDFMRF |
8 | Delia radicum | FMRFamide related peptide | FMRFamide-like neuropeptide PGQDFMRF-amide | 22848525#Zoephel J., Reiher W., Rexer K.-H., Kahnt J., Wegener C.; #Peptidomics of the agriculturally damaging larval stage of the cabbage root fly Delia radicum (Diptera: Anthomyiidae).; #PLoS ONE 7:E41543-E41543(2012). | |
NP01695 | APGQDFMRF |
9 | Delia radicum | FMRFamide related peptide | FMRFamide-like neuropeptide APGQDFMRF-amide | 20869420#Audsley N., Matthews H.J., Down R.E., Weaver R.J.; #Neuropeptides associated with the central nervous system of the cabbage root fly, Delia radicum (L).; #Peptides 32:434-440(2011).$22848525#Zoephel J., Reiher W., Rexer K.-H., Kahnt J., Wegener C.; #"Peptidomics of the agriculturally damaging larval stage of the cabbage root fly Delia radicum (Diptera: Anthomyiidae)."; #PLoS ONE 7:E41543-E41543(2012). | |
NP01696 | TPGQDFMRF |
9 | Delia radicum | FMRFamide related peptide | FMRFamide-like neuropeptide TPGQDFMRF-amide | 20869420#Audsley N., Matthews H.J., Down R.E., Weaver R.J.; #Neuropeptides associated with the central nervous system of the cabbage root fly, Delia radicum (L).; #Peptides 32:434-440(2011).$22848525#Zoephel J., Reiher W., Rexer K.-H., Kahnt J., Wegener C.; #"Peptidomics of the agriculturally damaging larval stage of the cabbage root fly Delia radicum (Diptera: Anthomyiidae)."; #PLoS ONE 7:E41543-E41543(2012). | |
NP01697 | SAPGQDFMRF |
10 | Delia radicum | FMRFamide related peptide | FMRFamide-like neuropeptide SAPGQDFMRF-amide | 22848525#Zoephel J., Reiher W., Rexer K.-H., Kahnt J., Wegener C.; #Peptidomics of the agriculturally damaging larval stage of the cabbage root fly Delia radicum (Diptera: Anthomyiidae).; #PLoS ONE 7:E41543-E41543(2012). | |
NP01698 | LPEQDFMRF |
9 | Delia radicum | FMRFamide related peptide | FMRFamide-like neuropeptide LPEQDFMRF-amide | 22848525#Zoephel J., Reiher W., Rexer K.-H., Kahnt J., Wegener C.; #Peptidomics of the agriculturally damaging larval stage of the cabbage root fly Delia radicum (Diptera: Anthomyiidae).; #PLoS ONE 7:E41543-E41543(2012). | |
NP01699 | ALSGDAFLRF |
10 | Doryteuthis opalescens | FMRFamide related peptide | ALSGDAFLRF-amide | ||
NP01700 | FIRF |
4 | Doryteuthis opalescens | FMRFamide related peptide | FIRF-amide | ||
NP01701 | FLRF |
4 | Doryteuthis opalescens | FMRFamide related peptide | FLRF-amide | ||
NP01702 | FMRF |
4 | Doryteuthis opalescens | FMRFamide related peptide | FMRF-amide 1 | ||
NP01703 | ALSGDAFLRF |
10 | Doryteuthis pealeii | FMRFamide related peptide | ALSGDAFLRF-amide (By similarity) | ||
NP01704 | FIRF |
4 | Doryteuthis pealeii | FMRFamide related peptide | FIRF-amide (By similarity) | ||
NP01705 | FLRF |
4 | Doryteuthis pealeii | FMRFamide related peptide | FLRF-amide (By similarity) | ||
NP01706 | FMRF |
4 | Doryteuthis pealeii | FMRFamide related peptide | FMRF-amide 1 (By similarity) | ||
NP01707 | AAMDRY |
6 | Drosophila melanogaster | FMRFamide related peptide | AAMDRY-amide | ||
NP01708 | QAEQLPPEGSYAGSDELEGMA |
21 | Drosophila melanogaster | FMRFamide related peptide | Corticotropin-releasing factor-like | ||
NP01709 | DPKQDFMRF |
9 | Drosophila melanogaster | FMRFamide related peptide | DPKQDFMRF-amide | ||
NP01710 | SVQDNFMHF |
9 | Drosophila melanogaster | FMRFamide related peptide | FMRFamide A | ||
NP01711 | MDSNFIRF |
8 | Drosophila melanogaster | FMRFamide related peptide | MDSNFIRF-amide | ||
NP01712 | PDNFMRF |
7 | Drosophila melanogaster | FMRFamide related peptide | PDNFMRF-amide | ||
NP01713 | SAPQDFVRS |
9 | Drosophila melanogaster | FMRFamide related peptide | SAPQDFVRS-amide | ||
NP01714 | SDNFMRF |
7 | Drosophila melanogaster | FMRFamide related peptide | SDNFMRF-amide | ||
NP01715 | SPKQDFMRF |
9 | Drosophila melanogaster | FMRFamide related peptide | SPKQDFMRF-amide | ||
NP01716 | TPAEDFMRF |
9 | Drosophila melanogaster | FMRFamide related peptide | TPAEDFMRF-amide | ||
NP01717 | APPSDFMRF |
9 | Drosophila virilis | FMRFamide related peptide | APPSDFMRF-amide | ||
NP01718 | APSDFMRF |
8 | Drosophila virilis | FMRFamide related peptide | APSDFMRF-amide | ||
NP01719 | DPKQDFMRF |
9 | Drosophila virilis | FMRFamide related peptide | DPKQDFMRF-amide | ||
NP01720 | DPSQDFMRF |
9 | Drosophila virilis | FMRFamide related peptide | DPSQDFMRF-amide | ||
NP01721 | MDSNFMRF |
8 | Drosophila virilis | FMRFamide related peptide | MDSNFMRF-amide | ||
NP01722 | PDNFMRF |
7 | Drosophila virilis | FMRFamide related peptide | PDNFMRF-amide | ||
NP01723 | SAPTEFERN |
9 | Drosophila virilis | FMRFamide related peptide | SAPTEFERN-amide | ||
NP01724 | SDNFMRF |
7 | Drosophila virilis | FMRFamide related peptide | SDNFMRF-amide | ||
NP01725 | SLQDNFMHF |
9 | Drosophila virilis | FMRFamide related peptide | SLQDNFMHF-amide | ||
NP01726 | SPKQDFMRF |
9 | Drosophila virilis | FMRFamide related peptide | SPKQDFMRF-amide | ||
NP01727 | LPLRF |
5 | Gallus gallus | FMRFamide related peptide | FMRFamide-like neuropeptide | 6137771#Dockray G.J., Reeve J.R. Jr., Shively J., Gayton R.J., Barnard C.S.; #A novel active pentapeptide from chicken brain identified by antibodies to FMRFamide.; #Nature 305:328-330(1983). | |
NP01728 | KSAYMRF |
7 | Haemonchus contortus | FMRFamide related peptide | FMRFamide-like neuropeptide PF3 | 10391380#Marks N.J., Sangster N.C., Maule A.G., Halton D.W., Thompson D.P., Geary T.G., Shaw C.; #Structural characterisation and pharmacology of KHEYLRFamide (AF2) and KSAYMRFamide (PF3/AF8) from Haemonchus contortus.; #Mol. Biochem. Parasitol. 100:185-194(1999). | |
NP01729 | GDPFLRF |
7 | Helisoma trivolvis | FMRFamide related peptide | FMRFamide-like neuropeptide GDPFLRF-amide | ||
NP01730 | FLRF |
4 | Helisoma trivolvis | FMRFamide related peptide | FLRFamide | 7912428#Madrid K.P., Price D.A., Greenberg M.J., Khan H.R., Saleuddin A.S.M#FMRFamide-related peptides from the kidney of the snail, Helisoma#Peptides 15:31-36(1994) | |
NP01731 | FMRF |
4 | Helisoma trivolvis | FMRFamide related peptide | FMRFamide | ||
NP01732 | QDPFLRI |
7 | Helix aspersa | FMRFamide related peptide | KQDPFLRI-amide | ||
NP01733 | NDPFLRFGKKSDPFLRF |
17 | Helix aspersa | FMRFamide related peptide | NDPFLRFGKKSDPFLRF-amide | ||
NP01734 | QDPFLRF |
7 | Helix aspersa | FMRFamide related peptide | QDPFLRF-amide | 1980513#Price D.A., Lesser W., Lee T.D., Doble K.E., Greenberg M.J.; #Seven FMRFamide-related and two SCP-related cardioactive peptides from Helix.; #J. Exp. Biol. 154:421-437(1990). | |
NP01735 | QFYRF |
5 | Helix aspersa | FMRFamide related peptide | QFYRF-amide | ||
NP01736 | ENNNGYIRF |
9 | Helix aspersa | FMRFamide related peptide | ENNNGYIRF-amide | ||
NP01737 | SYGWAEGDTTDNEYLRF |
17 | Helix aspersa | FMRFamide related peptide | FMRFamide-like | ||
NP01738 | NDPFLRF |
7 | Helix aspersa | FMRFamide related peptide | NDPFLRF-amide | ||
NP01739 | NDPYLRF |
7 | Helix aspersa | FMRFamide related peptide | NDPYLRF-amide | 1980513#Price D.A., Lesser W., Lee T.D., Doble K.E., Greenberg M.J.; #Seven FMRFamide-related and two SCP-related cardioactive peptides from Helix.; #J. Exp. Biol. 154:421-437(1990). | |
NP01740 | SEPYLRF |
7 | Helix aspersa | FMRFamide related peptide | SEPYLRF-amide | 1980513#Price D.A., Lesser W., Lee T.D., Doble K.E., Greenberg M.J.; #Seven FMRFamide-related and two SCP-related cardioactive peptides from Helix.; #J. Exp. Biol. 154:421-437(1990). | |
NP01741 | FLRF |
4 | Helix aspersa | FMRFamide related peptide | FLRF-amide | 1980513#Price D.A., Lesser W., Lee T.D., Doble K.E., Greenberg M.J.; #Seven FMRFamide-related and two SCP-related cardioactive peptides from Helix.; #J. Exp. Biol. 154:421-437(1990). | |
NP01742 | FMRF |
4 | Helix aspersa | FMRFamide related peptide | FMRF-amide | 1980513#Price D.A., Lesser W., Lee T.D., Doble K.E., Greenberg M.J.; #Seven FMRFamide-related and two SCP-related cardioactive peptides from Helix.; #J. Exp. Biol. 154:421-437(1990). | |
NP01743 | AQSFLRL |
7 | Hemilobophasma montaguense | FMRFamide related peptide | Extended FMRFamide-1 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
NP01744 | PAPDSSFLRDP |
11 | Hemilobophasma montaguense | FMRFamide related peptide | Extended FMRFamide-10 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
NP01745 | SPALDDEHNDNFLRL |
15 | Hemilobophasma montaguense | FMRFamide related peptide | Extended FMRFamide-12 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
NP01746 | SDYLQLAR |
8 | Hemilobophasma montaguense | FMRFamide related peptide | Extended FMRFamide-2 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
NP01747 | GPSAFLRL |
8 | Hemilobophasma montaguense | FMRFamide related peptide | Extended FMRFamide-3 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
NP01748 | GVDSSFLRL |
9 | Hemilobophasma montaguense | FMRFamide related peptide | Extended FMRFamide-4 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
NP01749 | TDRNFLRL |
8 | Hemilobophasma montaguense | FMRFamide related peptide | Extended FMRFamide-5 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
NP01750 | ARSDNFVRL |
9 | Hemilobophasma montaguense | FMRFamide related peptide | Extended FMRFamide-7 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
NP01751 | ARTDNFVRL |
9 | Hemilobophasma montaguense | FMRFamide related peptide | Extended FMRFamide-8 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
NP01752 | GRGGASNYVRL |
11 | Hemilobophasma montaguense | FMRFamide related peptide | Extended FMRFamide-9 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
NP01753 | YLRF |
4 | Hirudo medicinalis | FMRFamide related peptide | FMRFamide-like neuropeptide YLRF-amide | 1686933#Evans B.D., Pohl J., Kartsonis M.A., Calabrese R.L.; #Identification of RFamide neuropeptides in the medicinal leech.; #Peptides 12:897-908(1991). | |
NP01754 | YMRF |
4 | Hirudo medicinalis | FMRFamide related peptide | FMRFamide-like neuropeptide YMRF-amide | 1686933#Evans B.D., Pohl J., Kartsonis M.A., Calabrese R.L.; #Identification of RFamide neuropeptides in the medicinal leech.; #Peptides 12:897-908(1991). | |
NP01755 | GGKYMRF |
7 | Hirudo medicinalis | FMRFamide related peptide | FMRFamide-like neuropeptide GGKYMRF-amide | 1686933#Evans B.D., Pohl J., Kartsonis M.A., Calabrese R.L.; #Identification of RFamide neuropeptides in the medicinal leech.; #Peptides 12:897-908(1991). | |
NP01756 | FLRF |
4 | Hirudo medicinalis | FMRFamide related peptide | FLRFamide | 1686933#Evans B.D., Pohl J., Kartsonis M.A., Calabrese R.L.; #RT trivolvis#Peptides 12:897-908(1991). | |
NP01757 | FMRF |
4 | Hirudo medicinalis | FMRFamide related peptide | FMRFamide | 1686933#Evans B.D., Pohl J., Kartsonis M.A., Calabrese R.L.; #Identification of RFamide neuropeptides in the medicinal leech.; #Peptides 12:897-908(1991). | |
NP01758 | SDRNFLRF |
8 | Homarus americanus | FMRFamide related peptide | FMRFamide-like neuropeptide 3 | 3429714#Trimmer B.A., Kobierski L.A., Kravitz E.A.; #Purification and characterization of FMRFamidelike immunoreactive substances from the lobster nervous system: isolation and sequence analysis of two closely related peptides.; #J. Comp. Neurol. 266:16-26(1987). | |
NP01759 | TNRNFLRF |
8 | Homarus americanus | FMRFamide related peptide | FMRFamide-like neuropeptide 4 | 3429714#Trimmer B.A., Kobierski L.A., Kravitz E.A.; #Purification and characterization of FMRFamidelike immunoreactive substances from the lobster nervous system: isolation and sequence analysis of two closely related peptides.; #J. Comp. Neurol. 266:16-26(1987). | |
NP01760 | AGEGLNSQFWSLAAPQRF |
18 | Homo sapiens | FMRFamide related peptide | Neuropeptide AF | ||
NP01761 | FLFQPQRF |
8 | Homo sapiens | FMRFamide related peptide | Neuropeptide FF | ||
NP01762 | SQAFLFQPQRF |
11 | Homo sapiens | FMRFamide related peptide | Neuropeptide SF | ||
NP01763 | SLNFEELKDWGPKNVIKMSTPAVNKMPHSFANLPLRF |
37 | Homo sapiens | FMRFamide related peptide | Neuropeptide NPSF (Potential) | ||
NP01764 | VPNLPQRF |
8 | Homo sapiens | FMRFamide related peptide | Neuropeptide NPVF | 20027225#Ubuka T., Morgan K., Pawson A.J., Osugi T., Chowdhury V.S., Minakata H., Tsutsui K., Millar R.P., Bentley G.E.; #Identification of human GnIH homologs, RFRP-1 and RFRP-3, and the cognate receptor, GPR147 in the human hypothalamic pituitary axis.; #PLoS ONE 4:E8400-E8400(2009). | |
NP01765 | MPHSFANLPLRF |
12 | Homo sapiens | FMRFamide related peptide | Neuropeptide RFRP-1 | 20027225#Ubuka T., Morgan K., Pawson A.J., Osugi T., Chowdhury V.S., Minakata H., Tsutsui K., Millar R.P., Bentley G.E.; #Identification of human GnIH homologs, RFRP-1 and RFRP-3, and the cognate receptor, GPR147 in the human hypothalamic pituitary axis.; #PLoS ONE 4:E8400-E8400(2009). | |
NP01766 | SAGATANLPLRS |
12 | Homo sapiens | FMRFamide related peptide | Neuropeptide RFRP-2 (Potential) | ||
NP01767 | AQSFLRL |
7 | Karoophasma biedouwense | FMRFamide related peptide | Extended FMRFamide-1 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
NP01768 | PAPDSSFLRDP |
11 | Karoophasma biedouwense | FMRFamide related peptide | Extended FMRFamide-10 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
NP01769 | SPALDDEHNDNFLRL |
15 | Karoophasma biedouwense | FMRFamide related peptide | Extended FMRFamide-12 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
NP01770 | SDYLQLAR |
8 | Karoophasma biedouwense | FMRFamide related peptide | Extended FMRFamide-2 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
NP01771 | GPDSTFLRL |
9 | Karoophasma biedouwense | FMRFamide related peptide | Extended FMRFamide-3 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
NP01772 | GVDSSFLRL |
9 | Karoophasma biedouwense | FMRFamide related peptide | Extended FMRFamide-4 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
NP01773 | TDRNFLRL |
8 | Karoophasma biedouwense | FMRFamide related peptide | Extended FMRFamide-5 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
NP01774 | ARSDNFVRL |
9 | Karoophasma biedouwense | FMRFamide related peptide | Extended FMRFamide-7 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
NP01775 | ARTDNFVRL |
9 | Karoophasma biedouwense | FMRFamide related peptide | Extended FMRFamide-8 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
NP01776 | GRGGASNYVRL |
11 | Karoophasma biedouwense | FMRFamide related peptide | Extended FMRFamide-9 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
NP01777 | AQSFLRL |
7 | Karoophasma botterkloofense | FMRFamide related peptide | Extended FMRFamide-1 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
NP01778 | PAPESSFIRDP |
11 | Karoophasma botterkloofense | FMRFamide related peptide | Extended FMRFamide-10 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
NP01779 | SPALDDERNDNFIRL |
15 | Karoophasma botterkloofense | FMRFamide related peptide | Extended FMRFamide-12 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
NP01780 | SDYLQLAR |
8 | Karoophasma botterkloofense | FMRFamide related peptide | Extended FMRFamide-2 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
NP01781 | GPDSTFLRL |
9 | Karoophasma botterkloofense | FMRFamide related peptide | Extended FMRFamide-3 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
NP01782 | GVDSSFLRL |
9 | Karoophasma botterkloofense | FMRFamide related peptide | Extended FMRFamide-4 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
NP01783 | TDRNFLRL |
8 | Karoophasma botterkloofense | FMRFamide related peptide | Extended FMRFamide-5 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
NP01784 | ARSDNFVRL |
9 | Karoophasma botterkloofense | FMRFamide related peptide | Extended FMRFamide-7 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
NP01785 | ARTDNFVRL |
9 | Karoophasma botterkloofense | FMRFamide related peptide | Extended FMRFamide-8 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
NP01786 | GRGGASNYVRL |
11 | Karoophasma botterkloofense | FMRFamide related peptide | Extended FMRFamide-9 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
NP01787 | SIPNLPQRF |
9 | Lithobates catesbeiana | FMRFamide related peptide | fGRP-related peptide 1 | ||
NP01788 | YLSGKTKVQSMANLPQRF |
18 | Lithobates catesbeiana | FMRFamide related peptide | fGRP-related peptide 2 | ||
NP01789 | AQYTNHFVHSLDTLPLRF |
18 | Lithobates catesbeiana | FMRFamide related peptide | fGRP-related peptide 3 | ||
NP01790 | SLKPAANLPLRF |
12 | Lithobates catesbeiana | FMRFamide related peptide | Growth hormone-releasing peptide | 11796493#Koda A., Ukena K., Teranishi H., Ohta S., Yamamoto K., Kikuyama S., Tsutsui K.; #A novel amphibian hypothalamic neuropeptide: isolation, localization, and biological activity.; #Endocrinology 143:411-419(2002). | |
NP01791 | AQSFLRL |
7 | Lobatophasma redelinghuysense | FMRFamide related peptide | Extended FMRFamide-1 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
NP01792 | PAPDSSFIRDP |
11 | Lobatophasma redelinghuysense | FMRFamide related peptide | Extended FMRFamide-10 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
NP01793 | SPAFDDEHNDNFLRL |
15 | Lobatophasma redelinghuysense | FMRFamide related peptide | Extended FMRFamide-12 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
NP01794 | SDYLQLARG |
9 | Lobatophasma redelinghuysense | FMRFamide related peptide | Extended FMRFamide-2 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
NP01795 | LPDSSFLRL |
9 | Lobatophasma redelinghuysense | FMRFamide related peptide | Extended FMRFamide-3 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
NP01796 | GVDSSFLRL |
9 | Lobatophasma redelinghuysense | FMRFamide related peptide | Extended FMRFamide-4 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
NP01797 | TDRNFLRL |
8 | Lobatophasma redelinghuysense | FMRFamide related peptide | Extended FMRFamide-5 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
NP01798 | ARSDNFVRL |
9 | Lobatophasma redelinghuysense | FMRFamide related peptide | Extended FMRFamide-7 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
NP01799 | ARTDNFVRL |
9 | Lobatophasma redelinghuysense | FMRFamide related peptide | Extended FMRFamide-8 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
NP01800 | GHGGASNYVRL |
11 | Lobatophasma redelinghuysense | FMRFamide related peptide | Extended FMRFamide-9 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
NP01801 | PDVDHVFLRF |
10 | Locusta migratoria | FMRFamide related peptide | SchistoFLRFamide | 7687352#Schoofs L., Holman G.M., Paemen L., Veelaert D., Amelinckx M., de Loof A.; #Isolation, identification, and synthesis of PDVDHFLRFamide (SchistoFLRFamide) in Locusta migratoria and its association with the male accessory glands, the salivary glands, the heart, and the oviduct.; #Peptides 14:409-421(1993). | |
NP01802 | SVQDNFIRF |
9 | Lucilia cuprina | FMRFamide related peptide | FMRFamide-1 | 18789334#Rahman M.M., Fromm B., Neupert S., Kreusch S., Predel R.; #Extended FMRFamides in dipteran insects: conservative expression in the neuroendocrine system is accompanied by rapid sequence evolution.; #Gen. Comp. Endocrinol. 162:52-58(2009). | |
NP01803 | GPSQDFMRF |
9 | Lucilia cuprina | FMRFamide related peptide | FMRFamide-13 | 18789334#Rahman M.M., Fromm B., Neupert S., Kreusch S., Predel R.; #Extended FMRFamides in dipteran insects: conservative expression in the neuroendocrine system is accompanied by rapid sequence evolution.; #Gen. Comp. Endocrinol. 162:52-58(2009). | |
NP01804 | AGQDNFMRF |
9 | Lucilia cuprina | FMRFamide related peptide | FMRFamide-14 | 18789334#Rahman M.M., Fromm B., Neupert S., Kreusch S., Predel R.; #Extended FMRFamides in dipteran insects: conservative expression in the neuroendocrine system is accompanied by rapid sequence evolution.; #Gen. Comp. Endocrinol. 162:52-58(2009). | |
NP01805 | NPQQDFMRF |
9 | Lucilia cuprina | FMRFamide related peptide | FMRFamide-15 | 18789334#Rahman M.M., Fromm B., Neupert S., Kreusch S., Predel R.; #Extended FMRFamides in dipteran insects: conservative expression in the neuroendocrine system is accompanied by rapid sequence evolution.; #Gen. Comp. Endocrinol. 162:52-58(2009). | |
NP01806 | TPQQDFMRF |
9 | Lucilia cuprina | FMRFamide related peptide | FMRFamide-16 | 18789334#Rahman M.M., Fromm B., Neupert S., Kreusch S., Predel R.; #Extended FMRFamides in dipteran insects: conservative expression in the neuroendocrine system is accompanied by rapid sequence evolution.; #Gen. Comp. Endocrinol. 162:52-58(2009). | |
NP01807 | PDNFMRF |
7 | Lucilia cuprina | FMRFamide related peptide | FMRFamide-17 | 18789334#Rahman M.M., Fromm B., Neupert S., Kreusch S., Predel R.; #Extended FMRFamides in dipteran insects: conservative expression in the neuroendocrine system is accompanied by rapid sequence evolution.; #Gen. Comp. Endocrinol. 162:52-58(2009). | |
NP01808 | TPPQPADNFIRF |
12 | Lucilia cuprina | FMRFamide related peptide | FMRFamide-18 | 18789334#Rahman M.M., Fromm B., Neupert S., Kreusch S., Predel R.; #Extended FMRFamides in dipteran insects: conservative expression in the neuroendocrine system is accompanied by rapid sequence evolution.; #Gen. Comp. Endocrinol. 162:52-58(2009). | |
NP01809 | SANAKNDFMRF |
11 | Lucilia cuprina | FMRFamide related peptide | FMRFamide-19 | 18789334#Rahman M.M., Fromm B., Neupert S., Kreusch S., Predel R.; #Extended FMRFamides in dipteran insects: conservative expression in the neuroendocrine system is accompanied by rapid sequence evolution.; #Gen. Comp. Endocrinol. 162:52-58(2009). | |
NP01810 | GDNFMRF |
7 | Lucilia cuprina | FMRFamide related peptide | FMRFamide-2 | 18789334#Rahman M.M., Fromm B., Neupert S., Kreusch S., Predel R.; #Extended FMRFamides in dipteran insects: conservative expression in the neuroendocrine system is accompanied by rapid sequence evolution.; #Gen. Comp. Endocrinol. 162:52-58(2009). | |
NP01811 | SANTKNDFMRF |
11 | Lucilia cuprina | FMRFamide related peptide | FMRFamide-3 | 18789334#Rahman M.M., Fromm B., Neupert S., Kreusch S., Predel R.; #Extended FMRFamides in dipteran insects: conservative expression in the neuroendocrine system is accompanied by rapid sequence evolution.; #Gen. Comp. Endocrinol. 162:52-58(2009). | |
NP01812 | GGNDFMRF |
8 | Lucilia cuprina | FMRFamide related peptide | FMRFamide-4 | 18789334#Rahman M.M., Fromm B., Neupert S., Kreusch S., Predel R.; #Extended FMRFamides in dipteran insects: conservative expression in the neuroendocrine system is accompanied by rapid sequence evolution.; #Gen. Comp. Endocrinol. 162:52-58(2009). | |
NP01813 | SPTQDFMRF |
9 | Lucilia cuprina | FMRFamide related peptide | FMRFamide-5 | 18789334#Rahman M.M., Fromm B., Neupert S., Kreusch S., Predel R.; #Extended FMRFamides in dipteran insects: conservative expression in the neuroendocrine system is accompanied by rapid sequence evolution.; #Gen. Comp. Endocrinol. 162:52-58(2009). | |
NP01814 | AAASDNFMRF |
10 | Lucilia cuprina | FMRFamide related peptide | FMRFamide-6 | 18789334#Rahman M.M., Fromm B., Neupert S., Kreusch S., Predel R.; #Extended FMRFamides in dipteran insects: conservative expression in the neuroendocrine system is accompanied by rapid sequence evolution.; #Gen. Comp. Endocrinol. 162:52-58(2009). | |
NP01815 | QANQDFMRF |
9 | Lucilia cuprina | FMRFamide related peptide | FMRFamide-7 | 18789334#Rahman M.M., Fromm B., Neupert S., Kreusch S., Predel R.; #Extended FMRFamides in dipteran insects: conservative expression in the neuroendocrine system is accompanied by rapid sequence evolution.; #Gen. Comp. Endocrinol. 162:52-58(2009). | |
NP01816 | AAGQDFMRF |
9 | Lucilia cuprina | FMRFamide related peptide | FMRFamide-8 | 18789334#Rahman M.M., Fromm B., Neupert S., Kreusch S., Predel R.; #Extended FMRFamides in dipteran insects: conservative expression in the neuroendocrine system is accompanied by rapid sequence evolution.; #Gen. Comp. Endocrinol. 162:52-58(2009). | |
NP01817 | SPSQDFMRF |
9 | Lucilia cuprina | FMRFamide related peptide | FMRFamide-9/10/11/12 | 18789334#Rahman M.M., Fromm B., Neupert S., Kreusch S., Predel R.; #Extended FMRFamides in dipteran insects: conservative expression in the neuroendocrine system is accompanied by rapid sequence evolution.; #Gen. Comp. Endocrinol. 162:52-58(2009). | |
NP01818 | EFFPL |
5 | Lymnaea stagnalis | FMRFamide related peptide | EFFPL-amide | 2002360#Saunders S.E., Bright K., Kellett E., Benjamin P.R., Burke J.F.;#Neuropeptides Gly-Asp-Pro-Phe-Leu-Arg-Phe-amide (GDPFLRFamide) and Ser-Asp-Pro-Phe-Leu-Arg-Phe-amide (SDPFLRFamide) are encoded by an exon 3' to Phe-Met-Arg-Phe-NH2 (FMRFamide) in the snail Lymnaea stagnalis.;#J. Neurosci. 11:740-745(1991). | |
NP01819 | GDPFLRF |
7 | Lymnaea stagnalis | FMRFamide related peptide | GDPFLRF-amide 1 | 2002360#Saunders S.E., Bright K., Kellett E., Benjamin P.R., Burke J.F.;#Neuropeptides Gly-Asp-Pro-Phe-Leu-Arg-Phe-amide (GDPFLRFamide) and Ser-Asp-Pro-Phe-Leu-Arg-Phe-amide (SDPFLRFamide) are encoded by an exon 3' to Phe-Met-Arg-Phe-NH2 (FMRFamide) in the snail Lymnaea stagnalis.;#J. Neurosci. 11:740-745(1991). | |
NP01820 | HDYMRF |
6 | Lymnaea stagnalis | FMRFamide related peptide | HDYMRF-amide | ||
NP01821 | SDPFFRF |
7 | Lymnaea stagnalis | FMRFamide related peptide | SDPFFRF-amide | 2002360#Saunders S.E., Bright K., Kellett E., Benjamin P.R., Burke J.F.;#Neuropeptides Gly-Asp-Pro-Phe-Leu-Arg-Phe-amide (GDPFLRFamide) and Ser-Asp-Pro-Phe-Leu-Arg-Phe-amide (SDPFLRFamide) are encoded by an exon 3' to Phe-Met-Arg-Phe-NH2 (FMRFamide) in the snail Lymnaea stagnalis.;#J. Neurosci. 11:740-745(1991). | |
NP01822 | SDPFLRF |
7 | Lymnaea stagnalis | FMRFamide related peptide | SDPFLRF-amide 1 | 2002360#Saunders S.E., Bright K., Kellett E., Benjamin P.R., Burke J.F.;#Neuropeptides Gly-Asp-Pro-Phe-Leu-Arg-Phe-amide (GDPFLRFamide) and Ser-Asp-Pro-Phe-Leu-Arg-Phe-amide (SDPFLRFamide) are encoded by an exon 3' to Phe-Met-Arg-Phe-NH2 (FMRFamide) in the snail Lymnaea stagnalis.;#J. Neurosci. 11:740-745(1991). | |
NP01823 | SDPYLRF |
7 | Lymnaea stagnalis | FMRFamide related peptide | SDPYLRF-amide | 2002360#Saunders S.E., Bright K., Kellett E., Benjamin P.R., Burke J.F.;#Neuropeptides Gly-Asp-Pro-Phe-Leu-Arg-Phe-amide (GDPFLRFamide) and Ser-Asp-Pro-Phe-Leu-Arg-Phe-amide (SDPFLRFamide) are encoded by an exon 3' to Phe-Met-Arg-Phe-NH2 (FMRFamide) in the snail Lymnaea stagnalis.;#J. Neurosci. 11:740-745(1991). | |
NP01824 | SKPYMRF |
7 | Lymnaea stagnalis | FMRFamide related peptide | SKPYMRF-amide | 1421117#de With N.D., van der Schors R.C.; #SKPYMRFamide, a novel FMRFamide-related peptide in the snail Lymnaea stagnalis.; #NeuroReport 3:612-614(1992). | |
NP01825 | SSFPRY |
6 | Lymnaea stagnalis | FMRFamide related peptide | SSFPRY-amide | ||
NP01826 | EFLRI |
5 | Lymnaea stagnalis | FMRFamide related peptide | EFLRIamide | ||
NP01827 | FLRF |
4 | Lymnaea stagnalis | FMRFamide related peptide | FLRF-amide 1 | ||
NP01828 | FMRF |
4 | Lymnaea stagnalis | FMRFamide related peptide | FMRF-amide 1 | ||
NP01829 | SEQPDVDDYLRDVVLQSEEPLY |
22 | Lymnaea stagnalis | FMRFamide related peptide | PN | 7904219#Santama N., Li K.W., Bright K.E., Yeoman M., Geraerts W.P.M., Benjamin P.R., Burke J.F.; #Processing of the FMRFamide precursor protein in the snail Lymnaea stagnalis: characterization and neuronal localization of a novel peptide, 'SEEPLY'.; #Eur. J. Neurosci. 5:1003-1016(1993). | |
NP01830 | QFYRI |
5 | Lymnaea stagnalis | FMRFamide related peptide | QFYRI-amide | ||
NP01831 | DRNFLRF |
7 | Macrobrachium rosenbergii | FMRFamide related peptide | FMRFamide-like neuropeptide FLP1 | #Sithigorngul P., Saraithongkum W., Jaideechoey S., Longyant S., Sithigorngul W.; #Novel FMRFamide-like neuropeptides from the eyestalk of the giant freshwater prawn Macrobrachium rosenbergii.; #Comp. Biochem. Physiol. 120B:587-595(1998). | |
NP01832 | ADKNFLRF |
8 | Macrobrachium rosenbergii | FMRFamide related peptide | FMRFamide-like neuropeptide FLP2 | #Sithigorngul P., Saraithongkum W., Jaideechoey S., Longyant S., Sithigorngul W.; #Novel FMRFamide-like neuropeptides from the eyestalk of the giant freshwater prawn Macrobrachium rosenbergii.; #Comp. Biochem. Physiol. 120B:587-595(1998). | |
NP01833 | NYDKNFLRF |
9 | Macrobrachium rosenbergii | FMRFamide related peptide | FMRFamide-like neuropeptide FLP3 | #Sithigorngul P., Saraithongkum W., Jaideechoey S., Longyant S., Sithigorngul W.; #Novel FMRFamide-like neuropeptides from the eyestalk of the giant freshwater prawn Macrobrachium rosenbergii.; #Comp. Biochem. Physiol. 120B:587-595(1998). | |
NP01834 | APALRLRF |
8 | Macrobrachium rosenbergii | FMRFamide related peptide | FMRFamide-like neuropeptide FLP4 | #Sithigorngul P., Saraithongkum W., Jaideechoey S., Longyant S., Sithigorngul W.; #Novel FMRFamide-like neuropeptides from the eyestalk of the giant freshwater prawn Macrobrachium rosenbergii.; #Comp. Biochem. Physiol. 120B:587-595(1998). | |
NP01835 | DRTPALRLRF |
10 | Macrobrachium rosenbergii | FMRFamide related peptide | FMRFamide-like neuropeptide FLP5 | #Sithigorngul P., Saraithongkum W., Jaideechoey S., Longyant S., Sithigorngul W.; #Novel FMRFamide-like neuropeptides from the eyestalk of the giant freshwater prawn Macrobrachium rosenbergii.; #Comp. Biochem. Physiol. 120B:587-595(1998). | |
NP01836 | DGGRNFLRF |
9 | Macrobrachium rosenbergii | FMRFamide related peptide | FMRFamide-like neuropeptide FLP6 | 11179812#Sithigorngul P., Saraithongkum W., Longyant S., Panchan N., Sithigorngul W., Petsom A.; #Three more novel FMRFamide-like neuropeptide sequences from the eyestalk of the giant freshwater prawn Macrobrachium rosenbergii.; #Peptides 22:191-197(2001). | |
NP01837 | GYGDRNFLRF |
10 | Macrobrachium rosenbergii | FMRFamide related peptide | FMRFamide-like neuropeptide FLP7 | 11179812#Sithigorngul P., Saraithongkum W., Longyant S., Panchan N., Sithigorngul W., Petsom A.; #Three more novel FMRFamide-like neuropeptide sequences from the eyestalk of the giant freshwater prawn Macrobrachium rosenbergii.; #Peptides 22:191-197(2001). | |
NP01838 | VSHNNFLRF |
9 | Macrobrachium rosenbergii | FMRFamide related peptide | FMRFamide-like neuropeptide FLP8 | 11179812#Sithigorngul P., Saraithongkum W., Longyant S., Panchan N., Sithigorngul W., Petsom A.; #Three more novel FMRFamide-like neuropeptide sequences from the eyestalk of the giant freshwater prawn Macrobrachium rosenbergii.; #Peptides 22:191-197(2001). | |
NP01839 | FMRF |
4 | Macrocallista nimbosa | FMRFamide related peptide | FMRFamide | 877582#Price D.A., Greenberg M.J.; #Structure of a molluscan cardioexcitatory neuropeptide.; #Science 197:670-671(1977).$909875#Price D.A., Greenberg M.J.; #"Purification and characterization of a cardioexcitatory neuropeptide from the central ganglia of a bivalve mollusc."; #Prep. Biochem. 7:261-281(1977). | |
NP01840 | QDVVHSFLRF |
10 | Manduca sexta | FMRFamide related peptide | Myosuppressin | 2235684#Kingan T.G., Teplow D.B., Phillips J.M., Riehm J.P., Rao K.R., Hildebrand J.G., Homberg U., Kammer A.E., Jardine I., Griffin P.R., Hunt D.F.; #A new peptide in the FMRFamide family isolated from the CNS of the hawkmoth, Manduca sexta.; #Peptides 11:849-856(1990). | |
NP01841 | AQSFLRL |
7 | Mantophasma kudubergense | FMRFamide related peptide | Extended FMRFamide-1 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
NP01842 | PAASESGFRRDP |
12 | Mantophasma kudubergense | FMRFamide related peptide | Extended FMRFamide-10 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
NP01843 | SPGALEDEHNDNFLRF |
16 | Mantophasma kudubergense | FMRFamide related peptide | Extended FMRFamide-12 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
NP01844 | ADYLQLARA |
9 | Mantophasma kudubergense | FMRFamide related peptide | Extended FMRFamide-2 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
NP01845 | GPESAFLRL |
9 | Mantophasma kudubergense | FMRFamide related peptide | Extended FMRFamide-3 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
NP01846 | GVDSSFLRL |
9 | Mantophasma kudubergense | FMRFamide related peptide | Extended FMRFamide-4 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
NP01847 | TDRNFLRL |
8 | Mantophasma kudubergense | FMRFamide related peptide | Extended FMRFamide-5 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
NP01848 | ARSDNFVRL |
9 | Mantophasma kudubergense | FMRFamide related peptide | Extended FMRFamide-7 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
NP01849 | GRGGSSNYVRL |
11 | Mantophasma kudubergense | FMRFamide related peptide | Extended FMRFamide-9 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
NP01850 | GNFFRF |
6 | Moniezia expansa | FMRFamide related peptide | FMRFamide-like neuropeptide GNFFRF-amide | 8323531#Maule A.G., Shaw C., Halton D.W., Thim L.; #GNFFRFamide: a novel FMRFamide-immunoreactive peptide isolated from the sheep tapeworm, Moniezia expansa.; #Biochem. Biophys. Res. Commun. 193:1054-1060(1993). | |
NP01851 | QFWSLAAPQRF |
11 | Mus musculus | FMRFamide related peptide | Neuropeptide AF-like | ||
NP01852 | FLFQPQRF |
8 | Mus musculus | FMRFamide related peptide | Neuropeptide FF | ||
NP01853 | SPAFLFQPQRF |
11 | Mus musculus | FMRFamide related peptide | Neuropeptide SF | ||
NP01854 | SVSFQELKDWGAKNVIKMSPAPANKVPHSAANLPLRF |
37 | Mus musculus | FMRFamide related peptide | Neuropeptide NPSF (Potential) | ||
NP01855 | VNMEAGTRSHFPSLPQRF |
18 | Mus musculus | FMRFamide related peptide | Neuropeptide NPVF (Potential) | ||
NP01856 | VPHSAANLPLRF |
12 | Mus musculus | FMRFamide related peptide | Neuropeptide RFRP-1 (Potential) | ||
NP01857 | ASGGQDFMRF |
10 | Musca domestica | FMRFamide related peptide | MudFMRFamide-14 | 18789334#Rahman M.M., Fromm B., Neupert S., Kreusch S., Predel R.; #Extended FMRFamides in dipteran insects: conservative expression in the neuroendocrine system is accompanied by rapid sequence evolution.; #Gen. Comp. Endocrinol. 162:52-58(2009). | |
NP01858 | APSGQDFMRF |
10 | Musca domestica | FMRFamide related peptide | MudFMRFamide-15 | 18789334#Rahman M.M., Fromm B., Neupert S., Kreusch S., Predel R.; #Extended FMRFamides in dipteran insects: conservative expression in the neuroendocrine system is accompanied by rapid sequence evolution.; #Gen. Comp. Endocrinol. 162:52-58(2009). | |
NP01859 | TPAQSSDFMRF |
11 | Musca domestica | FMRFamide related peptide | MudFMRFamide-16 | 18789334#Rahman M.M., Fromm B., Neupert S., Kreusch S., Predel R.; #Extended FMRFamides in dipteran insects: conservative expression in the neuroendocrine system is accompanied by rapid sequence evolution.; #Gen. Comp. Endocrinol. 162:52-58(2009). | |
NP01860 | PDNFMRF |
7 | Musca domestica | FMRFamide related peptide | MudFMRFamide-17 | 18789334#Rahman M.M., Fromm B., Neupert S., Kreusch S., Predel R.; #Extended FMRFamides in dipteran insects: conservative expression in the neuroendocrine system is accompanied by rapid sequence evolution.; #Gen. Comp. Endocrinol. 162:52-58(2009). | |
NP01861 | TPTQSSDFMRF |
11 | Musca domestica | FMRFamide related peptide | MudFMRFamide-18 | 18789334#Rahman M.M., Fromm B., Neupert S., Kreusch S., Predel R.; #Extended FMRFamides in dipteran insects: conservative expression in the neuroendocrine system is accompanied by rapid sequence evolution.; #Gen. Comp. Endocrinol. 162:52-58(2009). | |
NP01862 | GDNFMRF |
7 | Musca domestica | FMRFamide related peptide | MudFMRFamide-2 | 18789334#Rahman M.M., Fromm B., Neupert S., Kreusch S., Predel R.; #Extended FMRFamides in dipteran insects: conservative expression in the neuroendocrine system is accompanied by rapid sequence evolution.; #Gen. Comp. Endocrinol. 162:52-58(2009). | |
NP01863 | SVGGSGGNDDNFMRF |
15 | Musca domestica | FMRFamide related peptide | MudFMRFamide-3 | 18789334#Rahman M.M., Fromm B., Neupert S., Kreusch S., Predel R.; #Extended FMRFamides in dipteran insects: conservative expression in the neuroendocrine system is accompanied by rapid sequence evolution.; #Gen. Comp. Endocrinol. 162:52-58(2009). | |
NP01864 | ASGSSDFMRF |
10 | Musca domestica | FMRFamide related peptide | MudFMRFamide-4 | 18789334#Rahman M.M., Fromm B., Neupert S., Kreusch S., Predel R.; #Extended FMRFamides in dipteran insects: conservative expression in the neuroendocrine system is accompanied by rapid sequence evolution.; #Gen. Comp. Endocrinol. 162:52-58(2009). | |
NP01865 | AGQDNFMRF |
9 | Musca domestica | FMRFamide related peptide | MudFMRFamide-5 | 18789334#Rahman M.M., Fromm B., Neupert S., Kreusch S., Predel R.; #Extended FMRFamides in dipteran insects: conservative expression in the neuroendocrine system is accompanied by rapid sequence evolution.; #Gen. Comp. Endocrinol. 162:52-58(2009). | |
NP01866 | AAGQDFMRF |
9 | Musca domestica | FMRFamide related peptide | MudFMRFamide-6 | 18789334#Rahman M.M., Fromm B., Neupert S., Kreusch S., Predel R.; #Extended FMRFamides in dipteran insects: conservative expression in the neuroendocrine system is accompanied by rapid sequence evolution.; #Gen. Comp. Endocrinol. 162:52-58(2009). | |
NP01867 | GSGQDFMRF |
9 | Musca domestica | FMRFamide related peptide | MudFMRFamide-7 | 18789334#Rahman M.M., Fromm B., Neupert S., Kreusch S., Predel R.; #Extended FMRFamides in dipteran insects: conservative expression in the neuroendocrine system is accompanied by rapid sequence evolution.; #Gen. Comp. Endocrinol. 162:52-58(2009). | |
NP01868 | SPGSQDFMRF |
10 | Musca domestica | FMRFamide related peptide | MudFMRFamide-8 | 18789334#Rahman M.M., Fromm B., Neupert S., Kreusch S., Predel R.; #Extended FMRFamides in dipteran insects: conservative expression in the neuroendocrine system is accompanied by rapid sequence evolution.; #Gen. Comp. Endocrinol. 162:52-58(2009). | |
NP01869 | NPGSQDFMRF |
10 | Musca domestica | FMRFamide related peptide | MudFMRFamide-9 | 18789334#Rahman M.M., Fromm B., Neupert S., Kreusch S., Predel R.; #Extended FMRFamides in dipteran insects: conservative expression in the neuroendocrine system is accompanied by rapid sequence evolution.; #Gen. Comp. Endocrinol. 162:52-58(2009). | |
NP01870 | ALAGDHFFRF |
10 | Mytilus edulis | FMRFamide related peptide | FMRFamide-like neuropeptide ALAGDHFFRF-amide | 1358534#Walker R.J.; #Neuroactive peptides with an RFamide or Famide carboxyl terminal.; #Comp. Biochem. Physiol. 102C:213-222(1992). | |
NP01871 | AQSFLRL |
7 | Namaquaphasma ookiepense | FMRFamide related peptide | Extended FMRFamide-1 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
NP01872 | PAPESNFVRDP |
11 | Namaquaphasma ookiepense | FMRFamide related peptide | Extended FMRFamide-10 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
NP01873 | SPSLDDERNDNFVRL |
15 | Namaquaphasma ookiepense | FMRFamide related peptide | Extended FMRFamide-12 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
NP01874 | SDYLQLAR |
8 | Namaquaphasma ookiepense | FMRFamide related peptide | Extended FMRFamide-2 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
NP01875 | GPDSAFLRL |
9 | Namaquaphasma ookiepense | FMRFamide related peptide | Extended FMRFamide-3 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
NP01876 | GVDSSFLRL |
9 | Namaquaphasma ookiepense | FMRFamide related peptide | Extended FMRFamide-4 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
NP01877 | TDRNFLRL |
8 | Namaquaphasma ookiepense | FMRFamide related peptide | Extended FMRFamide-5 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
NP01878 | GRAENFLRL |
9 | Namaquaphasma ookiepense | FMRFamide related peptide | Extended FMRFamide-6 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
NP01879 | ARSDNFVRL |
9 | Namaquaphasma ookiepense | FMRFamide related peptide | Extended FMRFamide-7 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
NP01880 | ARTDNFVRL |
9 | Namaquaphasma ookiepense | FMRFamide related peptide | Extended FMRFamide-8 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
NP01881 | GRGGASNYVRL |
11 | Namaquaphasma ookiepense | FMRFamide related peptide | Extended FMRFamide-9 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
NP01882 | SLTFEEVKDWGPKIKMNTPAVNKMPPSAANLPLRF |
35 | Ovis aries | FMRFamide related peptide | Neuropeptide NPSF (By similarity) | ||
NP01883 | VPNLPQRF |
8 | Ovis aries | FMRFamide related peptide | Neuropeptide NPVF (By similarity) | ||
NP01884 | MPPSAANLPLRF |
12 | Ovis aries | FMRFamide related peptide | Neuropeptide RFRP-1 (Potential) | ||
NP01885 | STRVMAHLPLRL |
12 | Ovis aries | FMRFamide related peptide | Neuropeptide RFRP-2 (Potential) | ||
NP01886 | AQSFLRL |
7 | Pachyphasma brandbergense | FMRFamide related peptide | Extended FMRFamide-1 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
NP01887 | SPALADEHNDNFLRF |
15 | Pachyphasma brandbergense | FMRFamide related peptide | Extended FMRFamide-12 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
NP01888 | SDYLQLART |
9 | Pachyphasma brandbergense | FMRFamide related peptide | Extended FMRFamide-2 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
NP01889 | GPESAFLRL |
9 | Pachyphasma brandbergense | FMRFamide related peptide | Extended FMRFamide-3 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
NP01890 | GVDSSFLRL |
9 | Pachyphasma brandbergense | FMRFamide related peptide | Extended FMRFamide-4 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
NP01891 | TDRNFLRL |
8 | Pachyphasma brandbergense | FMRFamide related peptide | Extended FMRFamide-5 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
NP01892 | ARSDNFVRL |
9 | Pachyphasma brandbergense | FMRFamide related peptide | Extended FMRFamide-7 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
NP01893 | GRGGASNYVRL |
11 | Pachyphasma brandbergense | FMRFamide related peptide | Extended FMRFamide-9 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
NP01894 | KHEYLRF |
7 | Panagrellus redivivus | FMRFamide related peptide | Neuropeptide AF2 | 7970891#Maule A.G., Shaw C., Bowman J.W.; #The FMRFamide-like neuropeptide AF2 (Ascaris suum) is present in the free-living nematode, Panagrellus redivivus (Nematoda, Rhabditida).; #Parasitology 109:351-356(1994). | |
NP01895 | SDPNFLRF |
8 | Panagrellus redivivus | FMRFamide related peptide | Neuropeptide PF1 | 1408999#Geary T.G., Price D.A., Bowman J.W., Winterrowd C.A., Mackenzie C.D., Garrison R.D., Williams J.F., Friedman A.R.; #Two FMRFamide-like peptides from the free-living nematode Panagrellus redivivus.; #Peptides 13:209-214(1992). | |
NP01896 | SADPNFLRF |
9 | Panagrellus redivivus | FMRFamide related peptide | FMRFamide-like neuropeptide PF2 | 1408999#Geary T.G., Price D.A., Bowman J.W., Winterrowd C.A., Mackenzie C.D., Garrison R.D., Williams J.F., Friedman A.R.; #Two FMRFamide-like peptides from the free-living nematode Panagrellus redivivus.; #Peptides 13:209-214(1992). | |
NP01897 | KSAYMRF |
7 | Panagrellus redivivus | FMRFamide related peptide | FMRFamide-like neuropeptide PF3 | 8179635#Maule A.G., Shaw C., Bowman J.W., Halton D.W., Thompson D.P., Geary T.G., Thim L.; #KSAYMRFamide: a novel FMRFamide-related heptapeptide from the free- living nematode, Panagrellus redivivus, which is myoactive in the parasitic nematode, Ascaris suum.; #Biochem. Biophys. Res. Commun. 200:973-980(1994). | |
NP01898 | KPNFIRF |
7 | Panagrellus redivivus | FMRFamide related peptide | Neuropeptide PF4 | 7716079#Maule A.G., Shaw C., Bowman J.W., Halton D.W., Thompson D.P., Thim L., Kubiak T.M., Martin R.A., Geary T.G.; #Isolation and preliminary biological characterization of KPNFIRFamide, a novel FMRFamide-related peptide from the free-living nematode, Panagrellus redivivus.; #Peptides 16:87-93(1995). | |
NP01899 | AMRNALVRF |
9 | Panagrellus redivivus | FMRFamide related peptide | FMRFamide-like neuropeptide PF5 | #Moffet C.L., Marks N.J., Halton D.W., Thomson D.P., Geary T.G., Maule A.G.; #Isolation, characterization and pharmacology of FMRFamide-related peptides (FaRPs) from free-living nematode, Panagrellus redivivus.; #Submitted (JUL-2000) to UniProtKB. | |
NP01900 | NGAPQPFVRF |
10 | Panagrellus redivivus | FMRFamide related peptide | FMRFamide-like neuropeptide PF6 | #Moffett C.L., Marks N.J., Halton D.W., Thomson D.P., Geary T.G., Maule A.G.; #Isolation, characterization and pharmacology of RMRFamide-related peptides (FaRPs) from free-living nematode, Panagrellus redivivus.; #Submitted (JUL-2000) to UniProtKB. | |
NP01901 | GDRNFLRF |
8 | Penaeus monodon | FMRFamide related peptide | FMRFamide-like neuropeptide FLP1 | 11959015#Sithigorngul P., Pupuem J., Krungkasem C., Longyant S., Chaivisuthangkura P., Sithigorngul W., Petsom A.; #Seven novel FMRFamide-like neuropeptide sequences from the eyestalk of the giant tiger prawn Penaeus monodon.; #Comp. Biochem. Physiol. 131B:325-337(2002). | |
NP01902 | AYSNLNYLRF |
10 | Penaeus monodon | FMRFamide related peptide | FMRFamide-like neuropeptide FLP2 | 11959015#Sithigorngul P., Pupuem J., Krungkasem C., Longyant S., Chaivisuthangkura P., Sithigorngul W., Petsom A.; #Seven novel FMRFamide-like neuropeptide sequences from the eyestalk of the giant tiger prawn Penaeus monodon.; #Comp. Biochem. Physiol. 131B:325-337(2002). | |
NP01903 | AQPSMRLRF |
9 | Penaeus monodon | FMRFamide related peptide | FMRFamide-like neuropeptide FLP3 | 11959015#Sithigorngul P., Pupuem J., Krungkasem C., Longyant S., Chaivisuthangkura P., Sithigorngul W., Petsom A.; #Seven novel FMRFamide-like neuropeptide sequences from the eyestalk of the giant tiger prawn Penaeus monodon.; #Comp. Biochem. Physiol. 131B:325-337(2002). | |
NP01904 | SQPSMRLRF |
9 | Penaeus monodon | FMRFamide related peptide | FMRFamide-like neuropeptide FLP4 | 11959015#Sithigorngul P., Pupuem J., Krungkasem C., Longyant S., Chaivisuthangkura P., Sithigorngul W., Petsom A.; #Seven novel FMRFamide-like neuropeptide sequences from the eyestalk of the giant tiger prawn Penaeus monodon.; #Comp. Biochem. Physiol. 131B:325-337(2002). | |
NP01905 | SMPSLRLRF |
9 | Penaeus monodon | FMRFamide related peptide | FMRFamide-like neuropeptide FLP5 | 11959015#Sithigorngul P., Pupuem J., Krungkasem C., Longyant S., Chaivisuthangkura P., Sithigorngul W., Petsom A.; #Seven novel FMRFamide-like neuropeptide sequences from the eyestalk of the giant tiger prawn Penaeus monodon.; #Comp. Biochem. Physiol. 131B:325-337(2002). | |
NP01906 | DGRTPALRLRF |
11 | Penaeus monodon | FMRFamide related peptide | FMRFamide-like neuropeptide FLP6 | 11959015#Sithigorngul P., Pupuem J., Krungkasem C., Longyant S., Chaivisuthangkura P., Sithigorngul W., Petsom A.; #Seven novel FMRFamide-like neuropeptide sequences from the eyestalk of the giant tiger prawn Penaeus monodon.; #Comp. Biochem. Physiol. 131B:325-337(2002). | |
NP01907 | GYRKPPFNGSIF |
12 | Penaeus monodon | FMRFamide related peptide | SIFamide | 11959015#Sithigorngul P., Pupuem J., Krungkasem C., Longyant S., Chaivisuthangkura P., Sithigorngul W., Petsom A.; #Seven novel FMRFamide-like neuropeptide sequences from the eyestalk of the giant tiger prawn Penaeus monodon.; #Comp. Biochem. Physiol. 131B:325-337(2002). | |
NP01908 | QLLAERH |
7 | Polyorchis penicillatus | FMRFamide related peptide | Neuropeptide | ||
NP01909 | QLLGGRF |
7 | Polyorchis penicillatus | FMRFamide related peptide | Pol-RFamide-I | ||
NP01910 | QWLKGRF |
7 | Polyorchis penicillatus | FMRFamide related peptide | Pol-RFamide-II | ||
NP01911 | AQSFLRL |
7 | Praedatophasma maraisi | FMRFamide related peptide | Extended FMRFamide-1 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
NP01912 | ADYLQLTRA |
9 | Praedatophasma maraisi | FMRFamide related peptide | Extended FMRFamide-2 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
NP01913 | GPETAFLRL |
9 | Praedatophasma maraisi | FMRFamide related peptide | Extended FMRFamide-3 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
NP01914 | GVDSSFLRL |
9 | Praedatophasma maraisi | FMRFamide related peptide | Extended FMRFamide-4 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
NP01915 | TDRNFLRL |
8 | Praedatophasma maraisi | FMRFamide related peptide | Extended FMRFamide-5 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
NP01916 | ARSDNFVRL |
9 | Praedatophasma maraisi | FMRFamide related peptide | Extended FMRFamide-7 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
NP01917 | GRGGPSNYVRL |
11 | Praedatophasma maraisi | FMRFamide related peptide | Extended FMRFamide-9 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
NP01918 | NRNFLRF |
7 | Procambarus clarkii | FMRFamide related peptide | Cardio-excitatory FMRFamide homolog NF1 | 8387183#Mercier A.J., Orchard I., Tebrugge V., Skerrett M.; #Isolation of two FMRFamide-related peptides from crayfish pericardial organs.; #Peptides 14:137-143(1993). | |
NP01919 | DRNFLRF |
7 | Procambarus clarkii | FMRFamide related peptide | Cardio-excitatory FMRFamide homolog DF2 | 8387183#Mercier A.J., Orchard I., Tebrugge V., Skerrett M.; #Isolation of two FMRFamide-related peptides from crayfish pericardial organs.; #Peptides 14:137-143(1993). | |
NP01920 | AGGDSLYEPGKALASACQVAVEACAAWFPGPE |
32 | Procambarus clarkii | FMRFamide related peptide | C-terminal peptide (Potential) | ||
NP01921 | GYRKPPFNGSIF |
12 | Procambarus clarkii | FMRFamide related peptide | GYRKPPFNGSIF-amide | 14723891#Yasuda A., Yasuda-Kamatani Y., Nozaki M., Nakajima T.; #Identification of GYRKPPFNGSIFamide (crustacean-SIFamide) in the crayfish Procambarus clarkii by topological mass spectrometry analysis.; #Gen. Comp. Endocrinol. 135:391-400(2004). | |
NP01922 | EFWSLAAPQRF |
11 | Rattus norvegicus | FMRFamide related peptide | Neuropeptide AF-like | ||
NP01923 | FLFQPQRF |
8 | Rattus norvegicus | FMRFamide related peptide | Neuropeptide FF | ||
NP01924 | NPAFLFQPQRF |
11 | Rattus norvegicus | FMRFamide related peptide | Neuropeptide SF | ||
NP01925 | SVTFQELKDWGAKKDIKMSPAPANKVPHSAANLPLRF |
37 | Rattus norvegicus | FMRFamide related peptide | Neuropeptide NPSF | ||
NP01926 | ANMEAGTMSHFPSLPQRF |
18 | Rattus norvegicus | FMRFamide related peptide | Neuropeptide NPVF | 11852091#Ukena K., Iwakoshi E., Minakata H., Tsutsui K.; #A novel rat hypothalamic RFamide-related peptide identified by immunoaffinity chromatography and mass spectrometry.; #FEBS Lett. 512:255-258(2002). | |
NP01927 | VPHSAANLPLRF |
12 | Rattus norvegicus | FMRFamide related peptide | Neuropeptide RFRP-1 (Potential) | ||
NP01928 | AKDNFLRF |
8 | Rhodnius prolixus | FMRFamide related peptide | FMRFamide-related protein 1 | 19137558#Ons S., Richter F., Urlaub H., Pomar R.R.; #The neuropeptidome of Rhodnius prolixus brain.; #Proteomics 9:788-792(2009). | |
NP01929 | TYKKPPFNGSIF |
12 | Rhodnius prolixus | FMRFamide related peptide | SIFamide related peptide | 19137558#Ons S., Richter F., Urlaub H., Pomar R.R.; #The neuropeptidome of Rhodnius prolixus brain.; #Proteomics 9:788-792(2009). | |
NP01930 | YKKPPFNGSIF |
11 | Rhodnius prolixus | FMRFamide related peptide | SIFamide related peptide(2-12) | 19137558#Ons S., Richter F., Urlaub H., Pomar R.R.; #The neuropeptidome of Rhodnius prolixus brain.; #Proteomics 9:788-792(2009). | |
NP01931 | KKPPFNGSIF |
10 | Rhodnius prolixus | FMRFamide related peptide | SIFamide related peptide(3-12) | 19137558#Ons S., Richter F., Urlaub H., Pomar R.R.; #The neuropeptidome of Rhodnius prolixus brain.; #Proteomics 9:788-792(2009). | |
NP01932 | KPPFNGSIF |
9 | Rhodnius prolixus | FMRFamide related peptide | SIFamide related peptide(4-12) | 19137558#Ons S., Richter F., Urlaub H., Pomar R.R.; #The neuropeptidome of Rhodnius prolixus brain.; #Proteomics 9:788-792(2009). | |
NP01933 | QPSQDFMRF |
9 | Sarcophaga bullata | FMRFamide related peptide | FMRFamide-1 | 12438685#Meeusen T., Mertens I., Clynen E., Baggerman G., Nichols R., Nachman R.J., Huybrechts R., De Loof A., Schoofs L.; #Identification in Drosophila melanogaster of the invertebrate G protein-coupled FMRFamide receptor.; #Proc. Natl. Acad. Sci. U.S.A. 99:15363-15368(2002).$18789334#Rahman M.M., Fromm B., Neupert S., Kreusch S., Predel R.;#Extended FMRFamides in dipteran insects: conservative expression in the neuroendocrine system is accompanied by rapid sequence evolution.#Gen. Comp. Endocrinol. 162:52-58(2009). | |
NP01934 | GDNFMRF |
7 | Sarcophaga bullata | FMRFamide related peptide | FMRFamide-10 | 18789334#Rahman M.M., Fromm B., Neupert S., Kreusch S., Predel R.; #Extended FMRFamides in dipteran insects: conservative expression in the neuroendocrine system is accompanied by rapid sequence evolution.; #Gen. Comp. Endocrinol. 162:52-58(2009). | |
NP01935 | SLNTKNDFMRF |
11 | Sarcophaga bullata | FMRFamide related peptide | FMRFamide-11 | 18789334#Rahman M.M., Fromm B., Neupert S., Kreusch S., Predel R.; #Extended FMRFamides in dipteran insects: conservative expression in the neuroendocrine system is accompanied by rapid sequence evolution.; #Gen. Comp. Endocrinol. 162:52-58(2009). | |
NP01936 | SAPSQDFMRF |
10 | Sarcophaga bullata | FMRFamide related peptide | FMRFamide-12 | 18789334#Rahman M.M., Fromm B., Neupert S., Kreusch S., Predel R.; #Extended FMRFamides in dipteran insects: conservative expression in the neuroendocrine system is accompanied by rapid sequence evolution.; #Gen. Comp. Endocrinol. 162:52-58(2009). | |
NP01937 | TNDFMRF |
7 | Sarcophaga bullata | FMRFamide related peptide | FMRFamide-13 | 18789334#Rahman M.M., Fromm B., Neupert S., Kreusch S., Predel R.; #Extended FMRFamides in dipteran insects: conservative expression in the neuroendocrine system is accompanied by rapid sequence evolution.; #Gen. Comp. Endocrinol. 162:52-58(2009). | |
NP01938 | DPHHDFMRF |
9 | Sarcophaga bullata | FMRFamide related peptide | FMRFamide-14 | 18789334#Rahman M.M., Fromm B., Neupert S., Kreusch S., Predel R.; #Extended FMRFamides in dipteran insects: conservative expression in the neuroendocrine system is accompanied by rapid sequence evolution.; #Gen. Comp. Endocrinol. 162:52-58(2009). | |
NP01939 | THDFMRF |
7 | Sarcophaga bullata | FMRFamide related peptide | FMRFamide-15 | 18789334#Rahman M.M., Fromm B., Neupert S., Kreusch S., Predel R.; #Extended FMRFamides in dipteran insects: conservative expression in the neuroendocrine system is accompanied by rapid sequence evolution.; #Gen. Comp. Endocrinol. 162:52-58(2009). | |
NP01940 | AAAGDNFMRF |
10 | Sarcophaga bullata | FMRFamide related peptide | FMRFamide-16 | 18789334#Rahman M.M., Fromm B., Neupert S., Kreusch S., Predel R.; #Extended FMRFamides in dipteran insects: conservative expression in the neuroendocrine system is accompanied by rapid sequence evolution.; #Gen. Comp. Endocrinol. 162:52-58(2009). | |
NP01941 | PDNFMRF |
7 | Sarcophaga bullata | FMRFamide related peptide | SabFMRFamide-17 | 18789334#Rahman M.M., Fromm B., Neupert S., Kreusch S., Predel R.; #Extended FMRFamides in dipteran insects: conservative expression in the neuroendocrine system is accompanied by rapid sequence evolution.; #Gen. Comp. Endocrinol. 162:52-58(2009). | |
NP01942 | APPQPSDNFIRF |
12 | Sarcophaga bullata | FMRFamide related peptide | FMRFamide-18 | 12438685#Meeusen T., Mertens I., Clynen E., Baggerman G., Nichols R., Nachman R.J., Huybrechts R., De Loof A., Schoofs L.; #Identification in Drosophila melanogaster of the invertebrate G protein-coupled FMRFamide receptor.; #Proc. Natl. Acad. Sci. U.S.A. 99:15363-15368(2002).$18789334#Rahman M.M., Fromm B., Neupert S., Kreusch S., Predel R.; #"Extended FMRFamides in dipteran insects: conservative expression in the neuroendocrine system is accompanied by rapid sequence evolution."; #Gen. Comp. Endocrinol. 162:52-58(2009). | |
NP01943 | TPSQDFMRF |
9 | Sarcophaga bullata | FMRFamide related peptide | FMRFamide-2 | 18789334#Rahman M.M., Fromm B., Neupert S., Kreusch S., Predel R.; #Extended FMRFamides in dipteran insects: conservative expression in the neuroendocrine system is accompanied by rapid sequence evolution.; #Gen. Comp. Endocrinol. 162:52-58(2009). | |
NP01944 | SPPSQDFMRF |
10 | Sarcophaga bullata | FMRFamide related peptide | FMRFamide-3 | 18789334#Rahman M.M., Fromm B., Neupert S., Kreusch S., Predel R.; #Extended FMRFamides in dipteran insects: conservative expression in the neuroendocrine system is accompanied by rapid sequence evolution.; #Gen. Comp. Endocrinol. 162:52-58(2009). | |
NP01945 | ASNQDFMRF |
9 | Sarcophaga bullata | FMRFamide related peptide | FMRFamide-4 | 18789334#Rahman M.M., Fromm B., Neupert S., Kreusch S., Predel R.; #Extended FMRFamides in dipteran insects: conservative expression in the neuroendocrine system is accompanied by rapid sequence evolution.; #Gen. Comp. Endocrinol. 162:52-58(2009). | |
NP01946 | LSPTQDFMRF |
10 | Sarcophaga bullata | FMRFamide related peptide | FMRFamide-5 | 18789334#Rahman M.M., Fromm B., Neupert S., Kreusch S., Predel R.; #Extended FMRFamides in dipteran insects: conservative expression in the neuroendocrine system is accompanied by rapid sequence evolution.; #Gen. Comp. Endocrinol. 162:52-58(2009). | |
NP01947 | TPTHDFMRF |
9 | Sarcophaga bullata | FMRFamide related peptide | FMRFamide-6 | 18789334#Rahman M.M., Fromm B., Neupert S., Kreusch S., Predel R.; #Extended FMRFamides in dipteran insects: conservative expression in the neuroendocrine system is accompanied by rapid sequence evolution.; #Gen. Comp. Endocrinol. 162:52-58(2009). | |
NP01948 | GSNDFMRF |
8 | Sarcophaga bullata | FMRFamide related peptide | FMRFamide-7 | 18789334#Rahman M.M., Fromm B., Neupert S., Kreusch S., Predel R.; #Extended FMRFamides in dipteran insects: conservative expression in the neuroendocrine system is accompanied by rapid sequence evolution.; #Gen. Comp. Endocrinol. 162:52-58(2009). | |
NP01949 | AGGADNFMRF |
10 | Sarcophaga bullata | FMRFamide related peptide | FMRFamide-8 | 18789334#Rahman M.M., Fromm B., Neupert S., Kreusch S., Predel R.; #Extended FMRFamides in dipteran insects: conservative expression in the neuroendocrine system is accompanied by rapid sequence evolution.; #Gen. Comp. Endocrinol. 162:52-58(2009). | |
NP01950 | GHADNFMRF |
9 | Sarcophaga bullata | FMRFamide related peptide | FMRFamide-9 | 18789334#Rahman M.M., Fromm B., Neupert S., Kreusch S., Predel R.; #Extended FMRFamides in dipteran insects: conservative expression in the neuroendocrine system is accompanied by rapid sequence evolution.; #Gen. Comp. Endocrinol. 162:52-58(2009). | |
NP01951 | PDVDHVFLRF |
10 | Schistocerca gregaria | FMRFamide related peptide | SchistoFLRFamide | 2719702#Robb S., Packman L.C., Evans P.D.; #Isolation, primary structure and bioactivity of schistoflrf-amide, a FMRF-amide-like neuropeptide from the locust, Schistocerca gregaria.; #Biochem. Biophys. Res. Commun. 160:850-856(1989). | |
NP01952 | ALSGDAFLRF |
10 | Sepia officinalis | FMRFamide related peptide | ALSGDAFLRF-amide | 11060217#Sweedler J.V., Li L., Floyd P., Gilly W.;#Mass spectrometric survey of peptides in cephalopods with an emphasis on the FMRFamide-related peptides.;#J. Exp. Biol. 203:3565-3573(2000). | |
NP01953 | FIRF |
4 | Sepia officinalis | FMRFamide related peptide | FIRF-amide | 11060217#Sweedler J.V., Li L., Floyd P., Gilly W.;#Mass spectrometric survey of peptides in cephalopods with an emphasis on the FMRFamide-related peptides.;#J. Exp. Biol. 203:3565-3573(2000). | |
NP01954 | FLRF |
4 | Sepia officinalis | FMRFamide related peptide | FLRF-amide | 11060217#Sweedler J.V., Li L., Floyd P., Gilly W.;#Mass spectrometric survey of peptides in cephalopods with an emphasis on the FMRFamide-related peptides.;#J. Exp. Biol. 203:3565-3573(2000). | |
NP01955 | FMRF |
4 | Sepia officinalis | FMRFamide related peptide | FMRF-amide 1 | 11060217#Sweedler J.V., Li L., Floyd P., Gilly W.;#Mass spectrometric survey of peptides in cephalopods with an emphasis on the FMRFamide-related peptides.;#J. Exp. Biol. 203:3565-3573(2000). | |
NP01956 | AQSFLRL |
7 | Striatophasma naukluftense | FMRFamide related peptide | Extended FMRFamide-1 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
NP01957 | PVPDSSFLRDP |
11 | Striatophasma naukluftense | FMRFamide related peptide | Extended FMRFamide-10 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
NP01958 | SPALDDEHNDNFLRL |
15 | Striatophasma naukluftense | FMRFamide related peptide | Extended FMRFamide-12 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
NP01959 | ADYLQLAR |
8 | Striatophasma naukluftense | FMRFamide related peptide | Extended FMRFamide-2 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
NP01960 | GPESAFLRL |
9 | Striatophasma naukluftense | FMRFamide related peptide | Extended FMRFamide-3 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
NP01961 | GVDSSFLRL |
9 | Striatophasma naukluftense | FMRFamide related peptide | Extended FMRFamide-4 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
NP01962 | TDRNFLRL |
8 | Striatophasma naukluftense | FMRFamide related peptide | Extended FMRFamide-5 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
NP01963 | GRADNFLRL |
9 | Striatophasma naukluftense | FMRFamide related peptide | Extended FMRFamide-6 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
NP01964 | ARSDNFVRL |
9 | Striatophasma naukluftense | FMRFamide related peptide | Extended FMRFamide-7 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
NP01965 | GRGGASNYVRL |
11 | Striatophasma naukluftense | FMRFamide related peptide | Extended FMRFamide-9 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
NP01966 | AQSFVRL |
7 | Tyrannophasma gladiator | FMRFamide related peptide | Extended FMRFamide-1 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
NP01967 | PASDSGFLRDP |
11 | Tyrannophasma gladiator | FMRFamide related peptide | Extended FMRFamide-10 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
NP01968 | SPVPEDDRGDNFVRL |
15 | Tyrannophasma gladiator | FMRFamide related peptide | Extended FMRFamide-12 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
NP01969 | ADYLRLARA |
9 | Tyrannophasma gladiator | FMRFamide related peptide | Extended FMRFamide-2 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
NP01970 | GPETAFFRL |
9 | Tyrannophasma gladiator | FMRFamide related peptide | Extended FMRFamide-3 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
NP01971 | GVDSSFVRL |
9 | Tyrannophasma gladiator | FMRFamide related peptide | Extended FMRFamide-4 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
NP01972 | TDRNFLRL |
8 | Tyrannophasma gladiator | FMRFamide related peptide | Extended FMRFamide-5 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
NP01973 | ARSDNFVRL |
9 | Tyrannophasma gladiator | FMRFamide related peptide | Extended FMRFamide-7 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
NP01974 | GRGASSNYVRL |
11 | Tyrannophasma gladiator | FMRFamide related peptide | Extended FMRFamide-9 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
NP01975 | AMRNALVRF |
9 | Ascaris suum | FMRFamide related peptide | Neuropeptide AF21 | 17436302#Yew JY, Davis R, Dikler S, Nanda J, Reinders B, Stretton AO#Peptide products of the afp-6 gene of the nematode Ascaris suum have different biological actions#J Comp Neurol 2007 Jun 10;502(5):872-82 | |
NP01976 | SGMRNALVRF |
10 | Ascaris suum | FMRFamide related peptide | Neuropeptide AF23 | 17436302#Yew JY, Davis R, Dikler S, Nanda J, Reinders B, Stretton AO#Peptide products of the afp-6 gene of the nematode Ascaris suum have different biological actions#J Comp Neurol 2007 Jun 10;502(5):872-82 | |
NP01977 | QDVDHVFLRF |
10 | Blattella germanica | FMRFamide related peptide | Leucomyosuppressin | 15093704#Aguilar R, Maestro JL, Vilaplana L, Chiva C, Andreu D, Bellés X#Identification of leucomyosuppressin in the German cockroach, Blattella germanica, as an inhibitor of food intake#Regul Pept 2004 Jun 15;119(1-2):105-12 | |
NP01978 | GPMGWVPVFYRF |
12 | Conus spurius | FMRFamide related peptide | Conorfamide-Sr1 | 11738233#Maillo M, Aguilar MB, Lopéz-Vera E, Craig AG, Bulaj G, Olivera BM, Heimer de la Cotera EP#Conorfamide, a Conus venom peptide belonging to the RFamide family of neuropeptides#Toxicon 2002 Apr;40(4):401-7 | |
NP01979 | QWLGGRFG |
8 | Hydra vulgaris | FMRFamide related peptide | Hydra-RFamide I | 9601069#Darmer D, Hauser F, Nothacker HP, Bosch TC, Williamson M, Grimmelikhuijzen CJ#Three different prohormones yield a variety of Hydra-RFamide (Arg-Phe-NH2) neuropeptides in Hydra magnipapillata#Biochem J 1998 Jun 1;332 ( Pt 2):403-12 | |
NP01980 | NGAPQPFVRF |
10 | Ascaris suum | FMRFamide related peptide | Neuropeptide AF22 | 21524146#Jarecki JL, Frey BL, Smith LM, Stretton AO#Discovery of neuropeptides in the nematode Ascaris suum by database mining and tandem mass spectrometry#J Proteome Res 2011 Jul 1;10(7):3098-106 | |
NP01981 | AYRKPPFNGSIF |
12 | Ixodes scapularis | FMRFamide related peptide | SIFamide | 19540946#Neupert S, Russell WK, Predel R, Russell DH, Strey OF, Teel PD, Nachman RJ#The neuropeptidomics of Ixodes scapularis synganglion#J Proteomics 2009 Aug 20;72(6):1040-5 | |
NP01982 | AEEQNQPPPV |
10 | Periplaneta americana | FMRFamide related peptide | Pea-FMRFa-1 | 15355317#Predel R, Neupert S, Wicher D, Gundel M, Roth S, Derst C#Unique accumulation of neuropeptides in an insect: FMRFamide-related peptides in the cockroach, Periplaneta americana#Eur J Neurosci 2004 Sep;20(6):1499-513 | |
NP01983 | GKSDNFIRF |
9 | Periplaneta americana | FMRFamide related peptide | Pea-FMRFa-10 | 15355317#Predel R, Neupert S, Wicher D, Gundel M, Roth S, Derst C#Unique accumulation of neuropeptides in an insect: FMRFamide-related peptides in the cockroach, Periplaneta americana#Eur J Neurosci 2004 Sep;20(6):1499-513 | |
NP01984 | ARPDNFIRF |
9 | Periplaneta americana | FMRFamide related peptide | Pea-FMRFa-11 | 15355317#Predel R, Neupert S, Wicher D, Gundel M, Roth S, Derst C#Unique accumulation of neuropeptides in an insect: FMRFamide-related peptides in the cockroach, Periplaneta americana#Eur J Neurosci 2004 Sep;20(6):1499-513 | |
NP01985 | GKQDFIRF |
8 | Periplaneta americana | FMRFamide related peptide | Pea-FMRFa-12 | 15355317#Predel R, Neupert S, Wicher D, Gundel M, Roth S, Derst C#Unique accumulation of neuropeptides in an insect: FMRFamide-related peptides in the cockroach, Periplaneta americana#Eur J Neurosci 2004 Sep;20(6):1499-513 | |
NP01986 | GNSNFVRF |
8 | Periplaneta americana | FMRFamide related peptide | Pea-FMRFa-13 | 15355317#Predel R, Neupert S, Wicher D, Gundel M, Roth S, Derst C#Unique accumulation of neuropeptides in an insect: FMRFamide-related peptides in the cockroach, Periplaneta americana#Eur J Neurosci 2004 Sep;20(6):1499-513 | |
NP01987 | DDSSNVETFDTEEEATTDSTLRV |
23 | Periplaneta americana | FMRFamide related peptide | Pea-FMRFa-14 | 15355317#Predel R, Neupert S, Wicher D, Gundel M, Roth S, Derst C#Unique accumulation of neuropeptides in an insect: FMRFamide-related peptides in the cockroach, Periplaneta americana#Eur J Neurosci 2004 Sep;20(6):1499-513 | |
NP01988 | GGKSGSNFIRF |
11 | Periplaneta americana | FMRFamide related peptide | Pea-FMRFa-15 | 15355317#Predel R, Neupert S, Wicher D, Gundel M, Roth S, Derst C#Unique accumulation of neuropeptides in an insect: FMRFamide-related peptides in the cockroach, Periplaneta americana#Eur J Neurosci 2004 Sep;20(6):1499-513 | |
NP01989 | ARPSSNFIRL |
10 | Periplaneta americana | FMRFamide related peptide | Pea-FMRFa-16 | 15355317#Predel R, Neupert S, Wicher D, Gundel M, Roth S, Derst C#Unique accumulation of neuropeptides in an insect: FMRFamide-related peptides in the cockroach, Periplaneta americana#Eur J Neurosci 2004 Sep;20(6):1499-513 | |
NP01990 | RDEEVTQREE |
10 | Periplaneta americana | FMRFamide related peptide | Pea-FMRFa-17 | 15355317#Predel R, Neupert S, Wicher D, Gundel M, Roth S, Derst C#Unique accumulation of neuropeptides in an insect: FMRFamide-related peptides in the cockroach, Periplaneta americana#Eur J Neurosci 2004 Sep;20(6):1499-513 | |
NP01991 | GRPSNNFVRF |
10 | Periplaneta americana | FMRFamide related peptide | Pea-FMRFa-18 | 15355317#Predel R, Neupert S, Wicher D, Gundel M, Roth S, Derst C#Unique accumulation of neuropeptides in an insect: FMRFamide-related peptides in the cockroach, Periplaneta americana#Eur J Neurosci 2004 Sep;20(6):1499-513 | |
NP01992 | RRCSNRNFVRL |
11 | Periplaneta americana | FMRFamide related peptide | Pea-FMRFa-2 | 15355317#Predel R, Neupert S, Wicher D, Gundel M, Roth S, Derst C#Unique accumulation of neuropeptides in an insect: FMRFamide-related peptides in the cockroach, Periplaneta americana#Eur J Neurosci 2004 Sep;20(6):1499-513 | |
NP01993 | SGNSNELRRGKL |
12 | Periplaneta americana | FMRFamide related peptide | Pea-FMRFa-20 | 15355317#Predel R, Neupert S, Wicher D, Gundel M, Roth S, Derst C#Unique accumulation of neuropeptides in an insect: FMRFamide-related peptides in the cockroach, Periplaneta americana#Eur J Neurosci 2004 Sep;20(6):1499-513 | |
NP01994 | TDRNFIRL |
8 | Periplaneta americana | FMRFamide related peptide | Pea-FMRFa-21 | 15355317#Predel R, Neupert S, Wicher D, Gundel M, Roth S, Derst C#Unique accumulation of neuropeptides in an insect: FMRFamide-related peptides in the cockroach, Periplaneta americana#Eur J Neurosci 2004 Sep;20(6):1499-513 | |
NP01995 | SGPSYDEKEQENEDGNSVRL |
20 | Periplaneta americana | FMRFamide related peptide | Pea-FMRFa-22 | 15355317#Predel R, Neupert S, Wicher D, Gundel M, Roth S, Derst C#Unique accumulation of neuropeptides in an insect: FMRFamide-related peptides in the cockroach, Periplaneta americana#Eur J Neurosci 2004 Sep;20(6):1499-513 | |
NP01996 | SENPSNSRNFIRL |
13 | Periplaneta americana | FMRFamide related peptide | Pea-FMRFa-23 | 15355317#Predel R, Neupert S, Wicher D, Gundel M, Roth S, Derst C#Unique accumulation of neuropeptides in an insect: FMRFamide-related peptides in the cockroach, Periplaneta americana#Eur J Neurosci 2004 Sep;20(6):1499-513 | |
NP01997 | RALDQNLLVDEHLMRF |
16 | Periplaneta americana | FMRFamide related peptide | Pea-FMRFa-24 | 15355317#Predel R, Neupert S, Wicher D, Gundel M, Roth S, Derst C#Unique accumulation of neuropeptides in an insect: FMRFamide-related peptides in the cockroach, Periplaneta americana#Eur J Neurosci 2004 Sep;20(6):1499-513 | |
NP01998 | GHDFDQDDVNSSGEKDESLVRI |
22 | Periplaneta americana | FMRFamide related peptide | Pea-FMRFa-3 | 15355317#Predel R, Neupert S, Wicher D, Gundel M, Roth S, Derst C#Unique accumulation of neuropeptides in an insect: FMRFamide-related peptides in the cockroach, Periplaneta americana#Eur J Neurosci 2004 Sep;20(6):1499-513 | |
NP01999 | GGRSNDNFIRF |
11 | Periplaneta americana | FMRFamide related peptide | Pea-FMRFa-4 | 15355317#Predel R, Neupert S, Wicher D, Gundel M, Roth S, Derst C#Unique accumulation of neuropeptides in an insect: FMRFamide-related peptides in the cockroach, Periplaneta americana#Eur J Neurosci 2004 Sep;20(6):1499-513 | |
NP02000 | GGKNDNFIRF |
10 | Periplaneta americana | FMRFamide related peptide | Pea-FMRFa-5 | 15355317#Predel R, Neupert S, Wicher D, Gundel M, Roth S, Derst C#Unique accumulation of neuropeptides in an insect: FMRFamide-related peptides in the cockroach, Periplaneta americana#Eur J Neurosci 2004 Sep;20(6):1499-513 | |
NP02001 | GGKQDNFIRF |
10 | Periplaneta americana | FMRFamide related peptide | Pea-FMRFa-6 | 15355317#Predel R, Neupert S, Wicher D, Gundel M, Roth S, Derst C#Unique accumulation of neuropeptides in an insect: FMRFamide-related peptides in the cockroach, Periplaneta americana#Eur J Neurosci 2004 Sep;20(6):1499-513 | |
NP02002 | DRSDNFIRF |
9 | Periplaneta americana | FMRFamide related peptide | Pea-FMRFa-7 | 15355317#Predel R, Neupert S, Wicher D, Gundel M, Roth S, Derst C#Unique accumulation of neuropeptides in an insect: FMRFamide-related peptides in the cockroach, Periplaneta americana#Eur J Neurosci 2004 Sep;20(6):1499-513 | |
NP02003 | GKTDNFIRF |
9 | Periplaneta americana | FMRFamide related peptide | Pea-FMRFa-8 | 15355317#Predel R, Neupert S, Wicher D, Gundel M, Roth S, Derst C#Unique accumulation of neuropeptides in an insect: FMRFamide-related peptides in the cockroach, Periplaneta americana#Eur J Neurosci 2004 Sep;20(6):1499-513 | |
NP02004 | GRSDNFIRF |
9 | Periplaneta americana | FMRFamide related peptide | Pea-FMRFa-9 | 15355317#Predel R, Neupert S, Wicher D, Gundel M, Roth S, Derst C#Unique accumulation of neuropeptides in an insect: FMRFamide-related peptides in the cockroach, Periplaneta americana#Eur J Neurosci 2004 Sep;20(6):1499-513 | |
NP02005 | TPDINPAWYAGRGIRPVGRF |
20 | Bos taurus | FMRFamide related peptide | Prolactin-releasing peptide PrRP20 | ||
NP02006 | SRAHQHSMEIRTPDINPAWYAGRGIRPVGRF |
31 | Bos taurus | FMRFamide related peptide | Prolactin-releasing peptide PrRP31 | ||
NP02007 | TPDINPAWYASRGIRPVGRF |
20 | Homo sapiens | FMRFamide related peptide | Prolactin-releasing peptide PrRP20 | ||
NP02008 | SRTHRHSMEIRTPDINPAWYASRGIRPVGRF |
31 | Homo sapiens | FMRFamide related peptide | Prolactin-releasing peptide PrRP31 | ||
NP02009 | TPDINPAWYTGRGIRPVGRF |
20 | Rattus norvegicus | FMRFamide related peptide | Prolactin-releasing peptide PrRP20 | ||
NP02010 | SRAHQHSMETRTPDINPAWYTGRGIRPVGRF |
31 | Rattus norvegicus | FMRFamide related peptide | Prolactin-releasing peptide PrRP31 |