NPID | NP01925 |
Name | Neuropeptide NPSF |
Organism | Rattus norvegicus |
NCBI Taxa ID | 10116 |
Tissue Specificity | Isoform 1 is expressed at high levels in the hypothalamus and eye. Isoform 2 is specifically expressed in a region between the dorsomedial hypothalamic and ventromedial hypothalamic nuclei. |
Family | FMRFamide related peptide |
UniProt ID | NPVF_RAT |
Length | 37 |
Modification | |
Gene Ontology | |
Sequence | SVTFQELKDWGAKKDIKMSPAPANKVPHSAANLPLRF |
Properties | View |
Structure | NA |
Reference |