| NPID | NP01925 |
| Name | Neuropeptide NPSF |
| Organism | Rattus norvegicus |
| NCBI Taxa ID | 10116 |
| Tissue Specificity | Isoform 1 is expressed at high levels in the hypothalamus and eye. Isoform 2 is specifically expressed in a region between the dorsomedial hypothalamic and ventromedial hypothalamic nuclei. |
| Family | FMRFamide related peptide |
| UniProt ID | NPVF_RAT |
| Length | 37 |
| Modification | |
| Gene Ontology | |
| Sequence | SVTFQELKDWGAKKDIKMSPAPANKVPHSAANLPLRF |
| Properties | View |
| Structure | NA |
| Reference |