| NPID | NP01882 |
| Name | Neuropeptide NPSF (By similarity) |
| Organism | Ovis aries |
| NCBI Taxa ID | 9940 |
| Tissue Specificity | Expressed in hypothalamus, where it is localized to the dorsomedial hypothalamic nucleus (DMH), paraventricular nucleus (PVN), and to neuronal projections from the PVN to the neurosecretory zone of the median eminence. |
| Family | FMRFamide related peptide |
| UniProt ID | NPVF_SHEEP |
| Length | 35 |
| Modification | |
| Gene Ontology | |
| Sequence | SLTFEEVKDWGPKIKMNTPAVNKMPPSAANLPLRF |
| Properties | View |
| Structure | NA |
| Reference |