Neuropeptide Database

Total number of results for Glucagon are 242

Download as Fasta All

NPID	Sequence	Length	Organism	Family	Name	Peptide_REF
NP02274	YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQGAKVRL	42	Bos taurus	Glucagon	Growth hormone-releasing factor	6421287#Esch F, Böhlen P, Ling N, Brazeau P, Guillemin R#Isolation and characterization of the bovine hypothalamic growth hormone releasing factor#Biochem Biophys Res Commun 1983 Dec 28;117(3):772-9
NP02275	AGAPEPAEPAQPGVY	15	Bos taurus	Glucagon	Proline-rich peptide	19177842#Galoyan AA, Korochkin LI, Rybalkina EJ, Pavlova GV, Saburina IN, Zaraiski EI, Galoyan NA, Davtyan TK, Bezirganyan KB, Revishchin AV#Hypothalamic proline-rich polypeptide enhances bone marrow colony-forming cell proliferation and stromal progenitor cell differentiation#Cell Transplant 2008;17(9):1061-6
NP02276	YADAIFTNSYRKILGQLSARKLLQDIMNRQQERNQEQGAKVRL	43	Capra hircus	Glucagon	Growth hormone-releasing factor	6440561#Brazeau P, Böhlen P, Esch F, Ling N, Wehrenberg WB, Guillemin R#Growth hormone-releasing factor from ovine and caprine hypothalamus: isolation, sequence analysis and total synthesis#Biochem Biophys Res Commun 1984 Dec 14;125(2):606-14
NP02277	HSDAVFTDNYSRYRKQMAAKKYLNSVLA	28	Carassius auratus	Glucagon	vasoactive intestinal peptide	8536941#Uesaka T, Yano K, Yamasaki M, Ando M#Somatostatin-, vasoactive intestinal peptide-, and granulin-like peptides isolated from intestinal extracts of goldfish, Carassius auratus#Gen Comp Endocrinol 1995 Sep;99(3):298-306
NP02278	HSQGTFTSDYSKHLDSRYAQEFVQWLMNT	29	Chinchilla	Glucagon	glucagon	2235678#Eng J, Kleinman WA, Chu LS#Purification of peptide hormones from chinchilla pancreas by chemical assay#Peptides 1990 Jul-Aug;11(4):683-5
NP02279	YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL	44	NA	Glucagon	Growth hormone-releasing factor	6418166#Böhlen P, Esch F, Brazeau P, Ling N, Guillemin R#Isolation and characterization of the porcine hypothalamic growth hormone releasing factor#Biochem Biophys Res Commun 1983 Oct 31;116(2):726-34
NP02280	HADGVFTSDFSRLLGQLSAKKYLESLI	27	NA	Glucagon	Peptide HI	6947244#Tatemoto K, Mutt V#Isolation and characterization of the intestinal peptide porcine PHI (PHI-27), a new member of the glucagon--secretin family#Proc Natl Acad Sci U S A 1981 Nov;78(11):6603-7
NP02281	HAEGTFTSDMTSYLEEKAAKEFVDWLIKGRPK	32	Pyxicephalus adspersus	Glucagon	Glucagon-like peptide 1	10882553#Conlon JM, White AM, Platz JE#Islet hormones from the African bullfrog Pyxicephalus adspersus (Anura:Ranidae): structural characterization and phylogenetic implications#Gen Comp Endocrinol 2000 Jul;119(1):85-94
NP02282	HIDGIFTDSYSRY	13	Coturnix coturnix japonica	Glucagon	PACAP27	20298575#Scholz B, Alm H, Mattsson A, Nilsson A, Kultima K, Savitski MM, Fälth M, Sköld K, Brunström B, Andren PE, Dencker L#Neuropeptidomic analysis of the embryonic Japanese quail diencephalon#BMC Dev Biol 2010 Mar 18;10:30
NP02283	AVFTDNYSRF	10	Coturnix coturnix japonica	Glucagon	vasoactive intestinal peptide	20298575#Scholz B, Alm H, Mattsson A, Nilsson A, Kultima K, Savitski MM, Fälth M, Sköld K, Brunström B, Andren PE, Dencker L#Neuropeptidomic analysis of the embryonic Japanese quail diencephalon#BMC Dev Biol 2010 Mar 18;10:30
NP02284	HSDGTFTSELSRLRESARLQRLLQGLV	27	Canis familiaris	Glucagon	Secretin	3626755#Shinomura Y, Eng J, Yalow RS#Dog secretin: sequence and biologic activity#Life Sci 1987 Sep 7;41(10):1243-8
NP02285	HADGMFNKAYRKALGQLSARKYLHTLMAKRVGGGSMIEDDNEPLS	45	Cyprinus carpio	Glucagon	Somatoliberin	1475012#Vaughan JM, Rivier J, Spiess J, Peng C, Chang JP, Peter RE, Vale W#Isolation and characterization of hypothalamic growth-hormone releasing factor from common carp, Cyprinus carpio#Neuroendocrinology 1992 Oct;56(4):539-49
NP02286	HSDGLFTSEYSKMRGNAQVQKFIQNLM	27	Gallus gallus	Glucagon	Secretin	7460928#Nilsson A, Carlquist M, Jörnvall H, Mutt V#Isolation and characterization of chicken secretin#Eur J Biochem 1980 Nov;112(2):383-8
NP02287	HSDAVFTDNYSRIRKQMAVKKYINSLLA	28	Scyliorhinus canicula	Glucagon	vasoactive intestinal peptide	2441759#Dimaline R, Young J, Thwaites DT, Lee CM, Shuttleworth TJ, Thorndyke MC#A novel vasoactive intestinal peptide (VIP) from elasmobranch intestine has full affinity for mammalian pancreatic VIP receptors#Biochim Biophys Acta 1987 Aug 19;930(1):97-100 $#Dimaline R., Young J., Thwaites D.T., Lee C.M., Thorndyke M.C.#Amino acid sequence of a biologically active vasoactive intestinal peptide from the elasmobranch Scyliorhinus canicula.#Ann. N. Y. Acad. Sci. 527:621-623(1988).
NP02288	HSQGTFTSDYSKYLDTRRAQDFVQWLMST	29	Alligator mississippiensis	Glucagon	Glucagon
NP02289	HSDAVFTDNYSRFRKQMAVKKYLNSVLT	28	Alligator mississippiensis	Glucagon	Vasoactive intestinal peptide	8101369#Wang Y., Conlon J.M.#Neuroendocrine peptides (NPY, GRP, VIP, somatostatin) from the brain and stomach of the alligator.# Peptides 14:573-579(1993).
NP02290	HSQGTFTSDYSKYLDTRRAQDFVQWLMST	29	Anas platyrhynchos	Glucagon	Glucagon	4636745#Sundby F., Frandsen E.K., Thomsen J., Kristiansen K., Brunfeldt K.#Crystallization and amino acid sequence of duck glucagon.# FEBS Lett. 26:289-293(1972).
NP02291	HSQGTFTNDYSKYLDTRRAQDFVQWLMSTKRSGGIT	36	Atractosteus spatula	Glucagon	Glucagon-36	3282974#Pollock H.G., Kimmel J.R., Ebner K.E., Hamilton J.W., Rouse J.B., Lance V., Rawitch A.B.#Isolation of alligator gar (Lepisosteus spatula) glucagon, oxyntomodulin, and glucagon-like peptide: amino acid sequences of oxyntomodulin and glucagon-like peptide.# Gen. Comp. Endocrinol. 69:133-140(1988).
NP02292	HSQGTFTNDYSKYLDTRRAQDFVQWLMST	29	Atractosteus spatula	Glucagon	Glucagon	3311873#Pollock H.G., Kimmel J.R., Hamilton J.W., Rouse J.B., Ebner K.E., Lance V., Rawitch A.B.#Isolation and structures of alligator gar (Lepisosteus spatula) insulin and pancreatic polypeptide.#Gen. Comp. Endocrinol. 67:375-382(1987).
NP02293	HADGTYTSDVSSYLQDQAAKKFVTWLKQGQDRRE	34	Atractosteus spatula	Glucagon	Glucagon-like peptide	3282974#Pollock H.G., Kimmel J.R., Ebner K.E., Hamilton J.W., Rouse J.B., Lance V., Rawitch A.B.#Isolation of alligator gar (Lepisosteus spatula) glucagon, oxyntomodulin, and glucagon-like peptide: amino acid sequences of oxyntomodulin and glucagon-like peptide.# Gen. Comp. Endocrinol. 69:133-140(1988).
NP02294	HSEGTFSSDYSKYLDSRRAKDFVQWLMST	29	Callorhynchus milii	Glucagon	Glucagon	2690815#Berks B.C., Marshall C.J., Carne A., Galloway S.M., Cutfield J.F.#Isolation and structural characterization of insulin and glucagon from the holocephalan species Callorhynchus milii (elephantfish).# Biochem. J. 263:261-266(1989).
NP02295	HSQGTFTSDYSKYLDSRRAQDFVQWLMNT	29	Camelus dromedarius	Glucagon	Glucagon	4421675#Sundby F., Markussen J., Danho W.#Camel glucagon: isolation, crystallization and amino acid composition.# Horm. Metab. Res. 6:425-425(1974).
NP02296	RSLQDTEEKSRSFSAPQTEPLNDLDQMNEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA	69	Canis familiaris	Glucagon	Glicentin	3238052#Shinomura Y., Eng J., Yalow R.S.#Immunoreactive glucagons purified from dog pancreas, stomach and ileum.# Regul. Pept. 23:299-308(1988).
NP02297	RSLQDTEEKSRSFSAPQTEPLNDLDQMNED	30	Canis familiaris	Glucagon	Glicentin-related polypeptide (By similarity)
NP02298	HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA	37	Canis familiaris	Glucagon	Oxyntomodulin (By similarity)
NP02299	HSQGTFTSDYSKYLDSRRAQDFVQWLMNT	29	Canis familiaris	Glucagon	Glucagon (By similarity)
NP02300	HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG	37	Canis familiaris	Glucagon	Glucagon-like peptide 1
NP02301	HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG	31	Canis familiaris	Glucagon	Glucagon-like peptide 1(7-37)
NP02302	HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR	30	Canis familiaris	Glucagon	Glucagon-like peptide 1(7-36)
NP02303	HADGSFSDEMNTVLDTLATRDFINWLLQTKITD	33	Canis familiaris	Glucagon	Glucagon-like peptide 2 (By similarity)
NP02304	HSDAVFTDNYTRLRKQMAVKKYLNSILN	28	Canis familiaris	Glucagon	Vasoactive intestinal peptide	3748846#Eng J., Du B.-H., Raufman J.-P., Yalow R.S.#Purification and amino acid sequences of dog, goat and guinea pig VIPs.# Peptides 7 Suppl. 1:17-20(1986).
NP02305	YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL	44	Capra hircus	Glucagon	Somatoliberin	6440561#Brazeau P., Boehlen P., Esch F., Ling N., Wehrenberg W.B., Guillemin R.#Growth hormone-releasing factor from ovine and caprine hypothalamus: isolation, sequence analysis and total synthesis.# Biochem. Biophys. Res. Commun. 125:606-614(1984).
NP02306	HSDAVFTDNYTRLRKQMAVKKYLNSILN	28	Capra hircus	Glucagon	Vasoactive intestinal peptide	3748846#Eng J., Du B.-H., Raufman J.-P., Yalow R.S.#Purification and amino acid sequences of dog, goat and guinea pig VIPs.# Peptides 7 Suppl. 1:17-20(1986).
NP02307	VPLQDYHTSTETVEGLLARGQGFTTA	26	Carassius auratus	Glucagon	Glicentin-related polypeptide (By similarity)
NP02308	HSEGTFSNDYSKYLETRRAQDFVEWLMNS	29	Carassius auratus	Glucagon	Glucagon (By similarity)
NP02309	HAEGTYTSDISSFLRDQAAQNFVAWLKSGQPKQE	34	Carassius auratus	Glucagon	Glucagon-like peptide (By similarity)
NP02310	RSLQDTEEKPRSVSASQTDMLDDPDQMNEDKRHSQGTFTSDYSKYLDSRRAQQFLKWLLNVKRNRNNIA	69	Cavia porcellus	Glucagon	Glicentin (By similarity)
NP02311	RSLQDTEEKPRSVSASQTDMLDDPDQMNED	30	Cavia porcellus	Glucagon	Glicentin-related polypeptide (By similarity)
NP02312	HSQGTFTSDYSKYLDSRRAQQFLKWLLNVKRNRNNIA	37	Cavia porcellus	Glucagon	Oxyntomodulin	4048553#Conlon J.M., Hansen H.F., Schwartz T.W.#Primary structure of glucagon and a partial sequence of oxyntomodulin (glucagon-37) from the guinea pig.#Regul. Pept. 11:309-320(1985).
NP02313	HSQGTFTSDYSKYLDSRRAQQFLKWLLNV	29	Cavia porcellus	Glucagon	Glucagon	3956884#Huang C.G., Eng J., Pan Y.-C.E., Hulmes J.D., Yalow R.S.#Guinea pig glucagon differs from other mammalian glucagons.# Diabetes 35:508-512(1986).
NP02314	HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG	37	Cavia porcellus	Glucagon	Glucagon-like peptide 1 (By similarity)
NP02315	HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG	31	Cavia porcellus	Glucagon	Glucagon-like peptide 1(7-37) (By similarity)
NP02316	HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR	30	Cavia porcellus	Glucagon	Glucagon-like peptide 1(7-36) (By similarity)
NP02317	HADGSFSDEMNTILDNLATRDFINWLIQTKITD	33	Cavia porcellus	Glucagon	Glucagon-like peptide 2 (By similarity)
NP02318	HSDGTFTSELSRLRDSARLQRLLQGLV	27	Cavia porcellus	Glucagon	Secretin	2340294#Buscail L., Cauvin A., Gourlet P., Gossen D., de Neef P., Rathe J., Robberecht P., Vandermeers-Piret M.-C., Vandermeers A., Christophe J.#Purification and amino acid sequence of vasoactive intestinal peptide, peptide histidine isoleucinamide (1-27) and secretin from the small intestine of guinea pig.# Biochim. Biophys. Acta 1038:355-359(1990).
NP02319	HADGVFTSDYSRLLGQLSARKYLESLI	27	Cavia porcellus	Glucagon	Intestinal peptide PHI-27	2340294#Buscail L., Cauvin A., Gourlet P., Gossen D., de Neef P., Rathe J., Robberecht P., Vandermeers-Piret M.-C., Vandermeers A., Christophe J.#Purification and amino acid sequence of vasoactive intestinal peptide, peptide histidine isoleucinamide (1-27) and secretin from the small intestine of guinea pig.# Biochim. Biophys. Acta 1038:355-359(1990).
NP02320	HSDALFTDTYTRLRKQMAMKKYLNSVLN	28	Cavia porcellus	Glucagon	Vasoactive intestinal peptide	2340294#Buscail L., Cauvin A., Gourlet P., Gossen D., de Neef P., Rathe J., Robberecht P., Vandermeers-Piret M.-C., Vandermeers A., Christophe J.#Purification and amino acid sequence of vasoactive intestinal peptide, peptide histidine isoleucinamide (1-27) and secretin from the small intestine of guinea pig.# Biochim. Biophys. Acta 1038:355-359(1990).$3748846#Eng J., Du B.-H., Raufman J.-P., Yalow R.S.#Purification and amino acid sequences of dog, goat and guinea pig VIPs.#Peptides 7 Suppl. 1:17-20(1986).$4004849#Du B.-H., Eng J., Hulmes J.D., Chang M., Pan Y.-C.E., Yalow R.S.#Guinea pig has a unique mammalian VIP.#Biochem. Biophys. Res. Commun. 128:1093-1098(1985).
NP02321	HADGLLDRALRDILVQLSARKYLHSLTAVRVGEEEEDEEDSEPLS	45	Clarias macrocephalus	Glucagon	Growth hormone-releasing factor
NP02322	HSDGIFTDSYSRYRKQMAVKKYLAAVLGRRYRQRFRNK	38	Clarias macrocephalus	Glucagon	Pituitary adenylate cyclase-activating polypeptide
NP02323	HSQGTFTSDYSKYLDSRRAQDFVQWLMST	29	Didelphis virginiana	Glucagon	Glucagon	2695899#Yu J.-H., Eng J., Rattan S., Yalow R.S.#Opossum insulin, glucagon and pancreatic polypeptide: amino acid sequences.# Peptides 10:1195-1197(1989).
NP02324	HSDAVFTDNYSRFRKQMAAKKYLNS	25	Gadus morhua	Glucagon	Vasoactive intestinal peptide	#Thwaites D.T., Young J., Thorndyke M.C., Dimaline R.#Isolation and characterisation of two teleost VIP's.# Regul. Pept. 21:436-436(1988).
NP02325	NPLQDTEEKSRSFKASQSEPLDESRQLNEV	30	Gallus gallus	Glucagon	Glicentin-related polypeptide (By similarity)
NP02326	HSQGTFTSDYSKYLDSRRAQDFVQWLMST	29	Gallus gallus	Glucagon	Glucagon	1194290#Pollock H.G., Kimmel J.R.#Chicken glucagon. Isolation and amino acid sequence studies.# J. Biol. Chem. 250:9377-9380(1975).$2828209#Huang J., Eng J., Yalow R.S.#Chicken glucagon: sequence and potency in receptor assay.#Horm. Metab. Res. 19:542-544(1987).
NP02327	HSEFERHAEGTYTSDITSYLEGQAAKEFIAWLVNGRG	37	Gallus gallus	Glucagon	Glucagon-like peptide 1 (By similarity)
NP02328	HAEGTYTSDITSYLEGQAAKEFIAWLVNGRG	31	Gallus gallus	Glucagon	Glucagon-like peptide 1(7-37) (By similarity)
NP02329	HAEGTYTSDITSYLEGQAAKEFIAWLVNGR	30	Gallus gallus	Glucagon	Glucagon-like peptide 1(7-36) (By similarity)
NP02330	HADGTFTSDINKILDDMAAKEFLKWLINTKVTQ	33	Gallus gallus	Glucagon	Glucagon-like peptide 2 (By similarity)
NP02331	HADGIFSKAYRKLLGQLSARNYLHSLMAKRVGGASSGLGDEAEPLS	46	Gallus gallus	Glucagon	Growth hormone-releasing factor 1-46
NP02332	HIDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK	38	Gallus gallus	Glucagon	Pituitary adenylate cyclase-activating polypeptide 38	#Yasuhara T., Mizuno K., Somogyvari-Vigh A., Komaki G., Arimura A.#Isolation and primary structure of chicken PACAP.# Regul. Pept. 37:326-326(1992).
NP02333	HIDGIFTDSYSRYRKQMAVKKYLAAVL	27	Gallus gallus	Glucagon	Pituitary adenylate cyclase-activating polypeptide 27	#Yasuhara T., Mizuno K., Somogyvari-Vigh A., Komaki G., Arimura A.#Isolation and primary structure of chicken PACAP.# Regul. Pept. 37:326-326(1992).
NP02334	HADGIFTSVYSHLLAKLAVKRYLHSLI	27	Gallus gallus	Glucagon	Intestinal peptide PHI-27-like
NP02335	HSDAVFTDNYSRFRKQMAVKKYLNSVLT	28	Gallus gallus	Glucagon	Vasoactive intestinal peptide	1227973#Nilsson A.#Structure of the vasoactive intestinal octacosapeptide from chicken intestine. The amino acid sequence.# FEBS Lett. 60:322-326(1975).$#Bodanszky M., Lin C.Y., Yiotakis A.E., Mutt V., Said S.I.#Vasoactive intestinal peptide (VIP) from chicken. Synthesis and properties of the C-terminal hendecapeptide.#Bioorg. Chem. 5:339-350(1976).
NP02336	SPLQETEEKSRSFKASQAEPLDDSRQLNEV	30	Heloderma suspectum	Glucagon	Glicentin-related polypeptide (By similarity)
NP02337	HSQGTFTSDYSKYLDTRRAQDFVQWLMNT	29	Heloderma suspectum	Glucagon	Glucagon (By similarity)
NP02338	HAEYERHADGRYTSDISSYLEGQAAKEFIAWLVNGRG	37	Heloderma suspectum	Glucagon	Glucagon-like peptide 1 (By similarity)
NP02339	HADGRYTSDISSYLEGQAAKEFIAWLVNGRG	31	Heloderma suspectum	Glucagon	Glucagon-like peptide 1(7-37) (By similarity)
NP02340	HADGRYTSDISSYLEGQAAKEFIAWLVNGR	30	Heloderma suspectum	Glucagon	Glucagon-like peptide 1(7-36) (By similarity)
NP02341	HADGTFTSDYNQLLDDIATQEFLKWLINQKVTQ	33	Heloderma suspectum	Glucagon	Glucagon-like peptide 2 (By similarity)
NP02342	IFNKAYRKVLGQLSARKYLHSLM	23	Heloderma suspectum	Glucagon	PACAP-related peptide
NP02343	HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQ	33	Heloderma suspectum	Glucagon	Pituitary adenylate cyclase-activating polypeptide 38
NP02344	HSDGIFTDSYSRYRKQMAVKKYLAAVL	27	Heloderma suspectum	Glucagon	Pituitary adenylate cyclase-activating polypeptide 27
NP02345	HSEGTFSNDYSKYLETRRAQDFVQWLMNS	29	Ictalurus punctatus	Glucagon	Glucagon	3030323#Hoosein N.M., Mahrenholz A.M., Andrews P.C., Gurd R.S.#Biological activities of catfish glucagon and glucagon-like peptide.# Biochem. Biophys. Res. Commun. 143:87-92(1987).$3838546#Andrews P.C., Ronner P.#Isolation and structures of glucagon and glucagon-like peptide from catfish pancreas.#J. Biol. Chem. 260:3910-3914(1985).
NP02346	HADGTYTSDVSSYLQEQAAKDFITWLKSGQPKPE	34	Ictalurus punctatus	Glucagon	Glucagon-like peptide	3030323#Hoosein N.M., Mahrenholz A.M., Andrews P.C., Gurd R.S.#Biological activities of catfish glucagon and glucagon-like peptide.# Biochem. Biophys. Res. Commun. 143:87-92(1987).$3838546#Andrews P.C., Ronner P.#Isolation and structures of glucagon and glucagon-like peptide from catfish pancreas.#J. Biol. Chem. 260:3910-3914(1985).
NP02347	HSQGTFTSDYSKYLDSRRAQDFVQWLMNSKRSGGIS	36	Lithobates catesbeiana	Glucagon	Glucagon-36	3260236#Pollock H.G., Hamilton J.W., Rouse J.B., Ebner K.E., Rawitch A.B.#Isolation of peptide hormones from the pancreas of the bullfrog (Rana catesbeiana). Amino acid sequences of pancreatic polypeptide, oxyntomodulin, and two glucagon-like peptides.# J. Biol. Chem. 263:9746-9751(1988).
NP02348	HSQGTFTSDYSKYLDSRRAQDFVQWLMNS	29	Lithobates catesbeiana	Glucagon	Glucagon	3260236#Pollock H.G., Hamilton J.W., Rouse J.B., Ebner K.E., Rawitch A.B.#Isolation of peptide hormones from the pancreas of the bullfrog (Rana catesbeiana). Amino acid sequences of pancreatic polypeptide, oxyntomodulin, and two glucagon-like peptides.# J. Biol. Chem. 263:9746-9751(1988).
NP02349	HADGTFTSDMSSYLEEKAAKEFVDWLIKGRPK	32	Lithobates catesbeiana	Glucagon	Glucagon-like peptide 1	3260236#Pollock H.G., Hamilton J.W., Rouse J.B., Ebner K.E., Rawitch A.B.#Isolation of peptide hormones from the pancreas of the bullfrog (Rana catesbeiana). Amino acid sequences of pancreatic polypeptide, oxyntomodulin, and two glucagon-like peptides.# J. Biol. Chem. 263:9746-9751(1988).
NP02350	HADGSFTSDFNKALDIKAAQEFLDWIINTPVKE	33	Lithobates catesbeiana	Glucagon	Glucagon-like peptide 2	3260236#Pollock H.G., Hamilton J.W., Rouse J.B., Ebner K.E., Rawitch A.B.#Isolation of peptide hormones from the pancreas of the bullfrog (Rana catesbeiana). Amino acid sequences of pancreatic polypeptide, oxyntomodulin, and two glucagon-like peptides.# J. Biol. Chem. 263:9746-9751(1988).
NP02351	QEADPSSSLEADSTLKDEPRELSNM	25	Lophius americanus	Glucagon	Glicentin-related polypeptide (By similarity)
NP02352	HSEGTFSNDYSKYLEDRKAQEFVRWLMNN	29	Lophius americanus	Glucagon	Glucagon-1	3058456#Nichols R., Lee T.D., Andrews P.C.#Pancreatic proglucagon processing: isolation and structures of glucagon and glucagon-like peptide from gene I.# Endocrinology 123:2639-2645(1988).
NP02353	HADGTFTSDVSSYLKDQAIKDFVDRLKAGQVRRE	34	Lophius americanus	Glucagon	Glucagon-like peptide 1 (By similarity)	3058456#Nichols R., Lee T.D., Andrews P.C.#Pancreatic proglucagon processing: isolation and structures of glucagon and glucagon-like peptide from gene I.# Endocrinology 123:2639-2645(1988).
NP02354	MPDQDPDRNSMLLNENSMLTEPIEPLNM	28	Lophius americanus	Glucagon	Glicentin-related polypeptide
NP02355	HSEGTFSNDYSKYLETRRAQDFVQWLKNS	29	Lophius americanus	Glucagon	Glucagon-2
NP02356	HADGTYTSDVSSYLQDQAAKDFVSWLKAGRG	31	Lophius americanus	Glucagon	Glucagon-like peptide 2
NP02357	HSQGTFTSDYSKYLDSRRAQDFVQWLMST	29	Meleagris gallopavo	Glucagon	Glucagon	4645932#Markussen J., Frandsen E.K., Heding L.G., Sundby F.#Turkey glucagon: crystallization, amino acid composition and immunology.# Horm. Metab. Res. 4:360-363(1972).
NP02358	HADGIFTTVYSHLLAKLAVKRYLHSLI	27	Meleagris gallopavo	Glucagon	Intestinal peptide PHI-27-like
NP02359	HSDAVFTDNYSRFRKQMAVKKYLNSVLT	28	Meleagris gallopavo	Glucagon	Vasoactive intestinal peptide
NP02360	HSLQDTEEKSRSFPASQTDPLEDPDQINEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA	69	Mesocricetus auratus	Glucagon	Glicentin (By similarity)
NP02361	HSLQDTEEKSRSFPASQTDPLEDPDQINED	30	Mesocricetus auratus	Glucagon	Glicentin-related polypeptide (By similarity)
NP02362	HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA	37	Mesocricetus auratus	Glucagon	Oxyntomodulin (By similarity)
NP02363	HSQGTFTSDYSKYLDSRRAQDFVQWLMNT	29	Mesocricetus auratus	Glucagon	Glucagon (By similarity)
NP02364	HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG	37	Mesocricetus auratus	Glucagon	Glucagon-like peptide 1 (By similarity)
NP02365	HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG	31	Mesocricetus auratus	Glucagon	Glucagon-like peptide 1(7-37) (By similarity)
NP02366	HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR	30	Mesocricetus auratus	Glucagon	Glucagon-like peptide 1(7-36) (By similarity)
NP02367	HADGSFSDEMNTILDSLATRDFINWLIQTKITD	33	Mesocricetus auratus	Glucagon	Glucagon-like peptide 2 (By similarity)
NP02368	YADAIFTSSYRKVLGQLSARKLLQDIMSRQQGERNQEQGPRVRL	44	Mesocricetus auratus	Glucagon	Somatoliberin
NP02369	LQDAEDSSRFDADDTLAGEARELSTP	26	Myoxocephalus scorpius	Glucagon	Glicentin-related polypeptide	3549298#Conlon J.M., Falkmer S., Thim L.#Primary structures of three fragments of proglucagon from the pancreatic islets of the daddy Sculpin (Cottus scorpius).# Eur. J. Biochem. 164:117-122(1987).
NP02370	HSEGTFSNDYSKYLETRRAQDFVQWLKNS	29	Myoxocephalus scorpius	Glucagon	Glucagon	3549298#Conlon J.M., Falkmer S., Thim L.#Primary structures of three fragments of proglucagon from the pancreatic islets of the daddy Sculpin (Cottus scorpius).# Eur. J. Biochem. 164:117-122(1987).
NP02371	HADGTFTSDVSSYLNDQAIKDFVAKLKSGKV	31	Myoxocephalus scorpius	Glucagon	Glucagon-like peptide	3549298#Conlon J.M., Falkmer S., Thim L.#Primary structures of three fragments of proglucagon from the pancreatic islets of the daddy Sculpin (Cottus scorpius).# Eur. J. Biochem. 164:117-122(1987).
NP02372	HPLQDTEEKPRSFSTSQTDLLDDPDQMNEDKRHSQGTFTSDYSKFLDTRRAQDFLDWLKNTKRNRNEIA	69	Octodon degus	Glucagon	Glicentin (By similarity)
NP02373	HPLQDTEEKPRSFSTSQTDLLDDPDQMNED	30	Octodon degus	Glucagon	Glicentin-related polypeptide (By similarity)
NP02374	HSQGTFTSDYSKFLDTRRAQDFLDWLKNTKRNRNEIA	37	Octodon degus	Glucagon	Oxyntomodulin (By similarity)
NP02375	HSQGTFTSDYSKFLDTRRAQDFLDWLKNT	29	Octodon degus	Glucagon	Glucagon (By similarity)
NP02376	HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG	37	Octodon degus	Glucagon	Glucagon-like peptide 1 (By similarity)
NP02377	HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG	31	Octodon degus	Glucagon	Glucagon-like peptide 1(7-37) (By similarity)
NP02378	HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR	30	Octodon degus	Glucagon	Glucagon-like peptide 1(7-36) (By similarity)
NP02379	HADGSFSDEMNTVLDHLATKDFINWLIQTKITD	33	Octodon degus	Glucagon	Glucagon-like peptide 2 (By similarity)
NP02380	HSEGTFSNDYSKYQEERMAQDFVQWLMNS	29	Oncorhynchus kisutch	Glucagon	Glucagon-1	3520699#Plisetskaya E., Pollock H.G., Rouse J.B., Hamilton J.W., Kimmel J.R., Gorbman A.#Isolation and structures of coho salmon (Oncorhynchus kisutch) glucagon and glucagon-like peptide.# Regul. Pept. 14:57-67(1986).
NP02381	HADGTYTSNVSTYLQDQAAKDFVSWLKSGRA	31	Oncorhynchus kisutch	Glucagon	Glucagon-like peptide 1-1	3520699#Plisetskaya E., Pollock H.G., Rouse J.B., Hamilton J.W., Kimmel J.R., Gorbman A.#Isolation and structures of coho salmon (Oncorhynchus kisutch) glucagon and glucagon-like peptide.# Regul. Pept. 14:57-67(1986).
NP02382	SPLQEAEDNSSLETTDPLLEDLMGVSNV	28	Oncorhynchus mykiss	Glucagon	Glicentin-related polypeptide 1
NP02383	HSEGTFSNDYSKYQEERMAQDFVQWLMNS	29	Oncorhynchus mykiss	Glucagon	Glucagon-1
NP02384	HADGTYTSDVSTYLQDQAAKDFVSWLKSGRA	31	Oncorhynchus mykiss	Glucagon	Glucagon-like peptide 1-1 (By similarity)
NP02385	HVDGSFTSDVNKVLDSLAAKEYLLWVMTSKTSG	33	Oncorhynchus mykiss	Glucagon	Glucagon-like peptide 2
NP02386	SPLQEAEDNSSLETADSLLEDLRGVPNM	28	Oncorhynchus mykiss	Glucagon	Glicentin-related polypeptide 2
NP02387	QSEGTFSNYYSKYQEERMARDFLHWLMNS	29	Oncorhynchus mykiss	Glucagon	Glucagon-2
NP02388	HADGTYTSDVSTYLQDQAAKDFVSWLKSGPA	31	Oncorhynchus mykiss	Glucagon	Glucagon-like peptide 1-2
NP02389	HADGMFNKAYRKALGQLSARKYLHSLMAKRVGGGSTMEDDTEPLS	45	Oncorhynchus nerka	Glucagon	Growth hormone-releasing factor
NP02390	HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYRQRYRNK	38	Oncorhynchus nerka	Glucagon	Pituitary adenylate cyclase-activating polypeptide
NP02391	HSQGTFTSDYSKYLDSRRAQDFVQWLMNT	29	Oryctolagus cuniculus	Glucagon	Glucagon	5011077#Sundby F., Markussen J.#Rabbit glucagon: isolation, crystallization and amino acid composition.# Horm. Metab. Res. 4:56-56(1972).
NP02392	HADGVFTSDFSRLLGQLSAKKYLESLI	27	Oryctolagus cuniculus	Glucagon	Intestinal peptide PHI-27	2342988#Gossen D., Buscail L., Cauvin A., Gourlet P., de Neef P., Rathe J., Robberecht P., Vandermeers-Piret M.C., Vandermeers A., Christophe J.#Amino acid sequence of VIP, PHI and secretin from the rabbit small intestine.# Peptides 11:123-128(1990).
NP02393	HSDAVFTDNYTRLRKQMAVKKYLNSILN	28	Oryctolagus cuniculus	Glucagon	Vasoactive intestinal peptide	2342988#Gossen D., Buscail L., Cauvin A., Gourlet P., de Neef P., Rathe J., Robberecht P., Vandermeers-Piret M.C., Vandermeers A., Christophe J.#Amino acid sequence of VIP, PHI and secretin from the rabbit small intestine.# Peptides 11:123-128(1990).
NP02394	HSLQNTEEKSSSFPAPQTDPLGDPDQISEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA	69	Ovis aries	Glucagon	Glicentin (By similarity)
NP02395	HSLQNTEEKSSSFPAPQTDPLGDPDQISED	30	Ovis aries	Glucagon	Glicentin-related polypeptide (By similarity)
NP02396	HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA	37	Ovis aries	Glucagon	Oxyntomodulin (By similarity)
NP02397	HSQGTFTSDYSKYLDSRRAQDFVQWLMNT	29	Ovis aries	Glucagon	Glucagon
NP02398	HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG	37	Ovis aries	Glucagon	Glucagon-like peptide 1 (By similarity)
NP02399	HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG	31	Ovis aries	Glucagon	Glucagon-like peptide 1(7-37) (By similarity)
NP02400	HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR	30	Ovis aries	Glucagon	Glucagon-like peptide 1(7-36) (By similarity)
NP02401	HADGSFSDEMNTVLDSLATRDFINWLLQTKI	31	Ovis aries	Glucagon	Glucagon-like peptide 2 (By similarity)
NP02402	DVAHGILDKAYRKVLDQLSARRYLQTLMAKGLGGTPGGGADDDSEPLS	48	Ovis aries	Glucagon	PACAP-related peptide
NP02403	HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK	38	Ovis aries	Glucagon	Pituitary adenylate cyclase-activating polypeptide 38
NP02404	HSDGIFTDSYSRYRKQMAVKKYLAAVL	27	Ovis aries	Glucagon	Pituitary adenylate cyclase-activating polypeptide 27	2383262#Miyata A., Jiang L., Dahl R.D., Kitada C., Kubo K., Fujino M., Minamino N., Arimura A.#Isolation of a neuropeptide corresponding to the N-terminal 27 residues of the pituitary adenylate cyclase activating polypeptide with 38 residues (PACAP38).# Biochem. Biophys. Res. Commun. 170:643-648(1990).
NP02405	HSDGTFTSELSRLRDSARLQRLLQGLV	27	Ovis aries	Glucagon	Secretin	2034821#Bounjoua Y., Vandermeers A., Robberecht P., Vandermeers-Piret M.C., Christophe J.#Purification and amino acid sequence of vasoactive intestinal peptide, peptide histidine isoleucinamide and secretin from the ovine small intestine.# Regul. Pept. 32:169-179(1991).
NP02406	HSDAVFTDNYTRLRKQMAVKKYLNSILN	28	Ovis aries	Glucagon	Vasoactive intestinal peptide	2235680#Gafvelin G.#Isolation and primary structure of VIP from sheep brain.# Peptides 11:703-706(1990).$2034821#Bounjoua Y., Vandermeers A., Robberecht P., Vandermeers-Piret M.C., Christophe J.#Purification and amino acid sequence of vasoactive intestinal peptide, peptide histidine isoleucinamide and secretin from the ovine small intestine.#Regul. Pept. 32:169-179(1991).$1574609#Miyata A., Jiang L., Stibbs H.H., Arimura A.#Chemical characterization of vasoactive intestinal polypeptide-like immunoreactivity in ovine hypothalamus and intestine.#Regul. Pept. 38:145-154(1992).
NP02407	HADDLLNKAYRNLLGQLSARKYLHTLMAKHLGAVSSSLEDDSEPLS	46	Pelophylax ridibundus	Glucagon	Growth hormone-releasing factor
NP02408	HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRIKNK	38	Pelophylax ridibundus	Glucagon	Pituitary adenylate cyclase-activating polypeptide 38	1720095#Chartrel N., Tonon M.-C., Vaudry H., Conlon J.M.#Primary structure of frog pituitary adenylate cyclase-activating polypeptide (PACAP) and effects of ovine PACAP on frog pituitary.# Endocrinology 129:3367-3371(1991).
NP02409	HSDGIFTDSYSRYRKQMAVKKYLAAVL	27	Pelophylax ridibundus	Glucagon	Pituitary adenylate cyclase-activating polypeptide 27	1720095#Chartrel N., Tonon M.-C., Vaudry H., Conlon J.M.#Primary structure of frog pituitary adenylate cyclase-activating polypeptide (PACAP) and effects of ovine PACAP on frog pituitary.# Endocrinology 129:3367-3371(1991).
NP02410	HSDAVFTDNYSRFRKQMAVKKYLNSVLT	28	Pelophylax ridibundus	Glucagon	Vasoactive intestinal peptide	7540547#Chartrel N., Wang Y., Fournier A., Vaudry H., Conlon J.M.#Frog vasoactive intestinal polypeptide and galanin: primary structures and effects on pituitary adenylate cyclase.# Endocrinology 136:3079-3086(1995).
NP02411	HSEGTFTSDYSKYLENKQAKDFVRWLMNA	29	Petromyzon marinus	Glucagon	Glucagon-1	8405897#Conlon J.M., Nielsen P.F., Youson J.H.#Primary structures of glucagon and glucagon-like peptide isolated from the intestine of the parasitic phase lamprey Petromyzon marinus.# Gen. Comp. Endocrinol. 91:96-104(1993).
NP02412	HADGTFTNDMTSYLDAKAARDFVSWLARSDKS	32	Petromyzon marinus	Glucagon	Glucagon-like peptide 1-I	8405897#Conlon J.M., Nielsen P.F., Youson J.H.#Primary structures of glucagon and glucagon-like peptide isolated from the intestine of the parasitic phase lamprey Petromyzon marinus.# Gen. Comp. Endocrinol. 91:96-104(1993).
NP02413	HAEDVNALLDRTMAKTFIEWLEKQNSNDQTD	31	Petromyzon marinus	Glucagon	Glucagon-like peptide 2-I (By similarity)
NP02414	HSQGSFTSDYSKHLDVKQAKDFVTWLLNT	29	Petromyzon marinus	Glucagon	Glucagon-2
NP02415	HSDGSFTNDMNVMLDRMSAKNFLEWLKQQGRG	32	Petromyzon marinus	Glucagon	Glucagon-like peptide 2-II
NP02416	HSEGTFSNDYSKYLETQRAQDFVQWLMNS	29	Piaractus mesopotamicus	Glucagon	Glucagon	10327603#de Lima J.A., Oliveira B., Conlon J.M.#Purification and characterization of insulin and peptides derived from proglucagon and prosomatostatin from the fruit-eating fish, the pacu Piaractus mesopotamicus.# Comp. Biochem. Physiol. 122B:127-135(1999).
NP02417	HADGTYTSDVSAYLQDQAAKDFITWLKSGQPKQE	34	Piaractus mesopotamicus	Glucagon	Glucagon-like peptide	10327603#de Lima J.A., Oliveira B., Conlon J.M.#Purification and characterization of insulin and peptides derived from proglucagon and prosomatostatin from the fruit-eating fish, the pacu Piaractus mesopotamicus.# Comp. Biochem. Physiol. 122B:127-135(1999).
NP02418	YAEGTFISDYSIAMDKIRQQDFVNWLLAQKGKKNDWKHNLTQ	42	Rattus norvegicus	Glucagon	Gastric inhibitory polypeptide
NP02419	HSQGTFTSDYSKYLDSRRAQDFVQWLMNT	29	Saimiri sciureus	Glucagon	Glucagon	2263627#Yu J.-H., Eng J., Yalow R.S.#Isolation and amino acid sequences of squirrel monkey (Saimiri sciurea) insulin and glucagon.# Proc. Natl. Acad. Sci. U.S.A. 87:9766-9768(1990).
NP02420	HSQGTFTSDYSKYLDTRRAQDFVQWLMST	29	Struthio camelus	Glucagon	Glucagon	1938110#Ferreira A., Litthauer D., Saayman H., Oelofsen W., Crabb J., Lazure C.#Purification and primary structure of glucagon from ostrich pancreas splenic lobes.# Int. J. Pept. Protein Res. 38:90-95(1991).
NP02421	YAEGTFISDYSIAMDKIRQQDFVNWLLAQKGKKSDWKHNITQ	42	Sus scrofa	Glucagon	Gastric inhibitory polypeptide	7227513#Joernvall H., Carlquist M., Kwauk S., Otte S.C., McIntosh C.H.S., Brown J.C., Mutt V.#Amino acid sequence and heterogeneity of gastric inhibitory polypeptide (GIP).# FEBS Lett. 123:205-210(1981).$8375398#Agerberth B., Boman A., Andersson M., Joernvall H., Mutt V., Boman H.G.#Isolation of three antibacterial peptides from pig intestine: gastric inhibitory polypeptide (7-42), diazepam-binding inhibitor (32-86) and a novel factor, peptide 3910.#Eur. J. Biochem. 216:623-629(1993).
NP02422	RSLQNTEEKSRSFPAPQTDPLDDPDQMTEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA	69	Sus scrofa	Glucagon	Glicentin	6894800#Thim L., Moody A.J.#The primary structure of porcine glicentin (proglucagon).# Regul. Pept. 2:139-150(1981).$7045833#Thim L., Moody A.J.#The amino acid sequence of porcine glicentin.#Peptides 2 Suppl. 2:37-39(1981).
NP02423	RSLQNTEEKSRSFPAPQTDPLDDPDQMTED	30	Sus scrofa	Glucagon	Glicentin-related polypeptide (By similarity)
NP02424	HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA	37	Sus scrofa	Glucagon	Oxyntomodulin (By similarity)
NP02425	HSQGTFTSDYSKYLDSRRAQDFVQWLMNT	29	Sus scrofa	Glucagon	Glucagon	#Bromer W.W., Sinn L.G., Behrens O.K.#The amino acid sequence of glucagon. V. Location of amide groups, acid degradation studies and summary of sequential evidence.#J. Am. Chem. Soc. 79:2807-2810(1957).
NP02426	HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG	37	Sus scrofa	Glucagon	Glucagon-like peptide 1 (By similarity)
NP02427	HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG	31	Sus scrofa	Glucagon	Glucagon-like peptide 1(7-37)	2753890#Orskov C., Bersani M., Johnsen A.H., Hoejrup P., Holst J.J.#Complete sequences of glucagon-like peptide-1 from human and pig small intestine.#J. Biol. Chem. 264:12826-12829(1989).
NP02428	HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR	30	Sus scrofa	Glucagon	Glucagon-like peptide 1(7-36)	2753890#Orskov C., Bersani M., Johnsen A.H., Hoejrup P., Holst J.J.#Complete sequences of glucagon-like peptide-1 from human and pig small intestine.#J. Biol. Chem. 264:12826-12829(1989).
NP02429	HADGSFSDEMNTVLDNLATRDFINWLLHTKITDSL	35	Sus scrofa	Glucagon	Glucagon-like peptide 2 (By similarity)
NP02430	DVAHGILNKAYRKVLDQLSARKYLQTLMAKSVGGNLDGGAEDDSEPLS	48	Sus scrofa	Glucagon	PACAP-related peptide
NP02431	HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK	38	Sus scrofa	Glucagon	Pituitary adenylate cyclase-activating polypeptide 38
NP02432	HSDGIFTDSYSRYRKQMAVKKYLAAVL	27	Sus scrofa	Glucagon	Pituitary adenylate cyclase-activating polypeptide 27	#Miyata A., Jiang L., Oka S., Yoshihara T., Arimura A.#Identification of porcine pituitary adenylate cyclase activating polypeptide with 27 residues in the hypothalamic extracts.# Regul. Pept. 37:325-325(1992).
NP02433	HSDGTFTSELSRLRDSARLQRLLQGLV	27	Sus scrofa	Glucagon	Secretin	8618828#Bonetto V., Joernvall H., Mutt V., Sillard R.#Two alternative processing pathways for a preprohormone: a bioactive form of secretin.# Proc. Natl. Acad. Sci. U.S.A. 92:11985-11989(1995).$5465996#Mutt V., Jorpes J.E., Magnusson S.#Structure of porcine secretin. The amino acid sequence.#Eur. J. Biochem. 15:513-519(1970).$2395872#Gafvelin G., Joernvall H., Mutt V.#Processing of prosecretin: isolation of a secretin precursor from porcine intestine.#Proc. Natl. Acad. Sci. U.S.A. 87:6781-6785(1990).
NP02434	YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL	44	Sus scrofa	Glucagon	Somatoliberin	6418166#Boehlen P., Esch F., Brazeau P., Ling N., Guillemin R.#Isolation and characterization of the porcine hypothalamic growth hormone releasing factor.# Biochem. Biophys. Res. Commun. 116:726-734(1983).
NP02435	HADGVFTSDFSRLLGQLSAKKYLESLI	27	Sus scrofa	Glucagon	Intestinal peptide PHI-27	6947244#Tatemoto K., Mutt V.#Isolation and characterization of the intestinal peptide porcine PHI (PHI-27), a new member of the glucagon-secretin family.# Proc. Natl. Acad. Sci. U.S.A. 78:6603-6607(1981).
NP02436	HSDAVFTDNYTRLRKQMAVKKYLNSILN	28	Sus scrofa	Glucagon	Vasoactive intestinal peptide	2843830#Gafvelin G., Andersson M., Dimaline R., Joernvall H., Mutt V.#Isolation and characterization of a variant form of vasoactive intestinal polypeptide.#Peptides 9:469-474(1988).$4829446#Mutt V., Said S.I.#Structure of the porcine vasoactive intestinal octacosapeptide. The amino-acid sequence. Use of kallikrein in its determination.#Eur. J. Biochem. 42:581-589(1974).
NP02437	HSEGTFTSDYSKYLDNRRAKDFVQWLMNT	29	Torpedo marmorata	Glucagon	Glucagon	4076759#Conlon J.M., Thim L.#Primary structure of glucagon from an elasmobranchian fish. Torpedo marmorata.# Gen. Comp. Endocrinol. 60:398-405(1985).
NP02438	HSQGTFTSDYSKYLDTRRAQDFVQWLMST	29	Trachemys scripta	Glucagon	Glucagon	1974347#Conlon J.M., Hicks J.W.#Isolation and structural characterization of insulin, glucagon and somatostatin from the turtle, Pseudemys scripta.# Peptides 11:461-466(1990).
NP02439	HSDGIFTDSYSRYRKQMAVQKYLAAVLGRRYRQRVRNK	38	Uranoscopus japonicus	Glucagon	Pituitary adenylate cyclase-activating polypeptide	9213367#Matsuda K., Takei Y., Katoh J., Shioda S., Arimura A., Uchiyama M.#Isolation and structural characterization of pituitary adenylate cyclase activating polypeptide (PACAP)-like peptide from the brain of a teleost, stargazer, Uranoscopus japonicus.# Peptides 18:723-727(1997).
NP02440	HSQGTFTSDYSKYLDSRRAQDFVQWLMNT	29	Xenopus laevis	Glucagon	Glucagon
NP02441	HAEGTFTSDVTQQLDEKAAKEFIDWLINGGPSKEIIS	37	Xenopus laevis	Glucagon	Glucagon-like peptide 1A
NP02442	HAEGTYTNDVTEYLEEKAAKEFIEWLIKGKP	31	Xenopus laevis	Glucagon	Glucagon-like peptide 1B
NP02443	HAEGTFTNDMTNYLEEKAAKEFVGWLIKGRP	31	Xenopus laevis	Glucagon	Glucagon-like peptide 1C
NP02444	HADGSFTNDINKVLDIIAAQEFLDWVINTQETE	33	Xenopus laevis	Glucagon	Glucagon-like peptide 2
NP02445	HAEGTFTSDVTQHLDEKAAKEFIDWLINGGPTKEIIS	37	Xenopus laevis	Glucagon	Glucagon-like peptide 1A
NP02446	HAEGTYTNDVTEYLEEKATKAFIEWLIKGKP	31	Xenopus laevis	Glucagon	Glucagon-like peptide 1B
NP02447	HAEGTFTNDMTNYLEEKAAKEFVGWLINGRP	31	Xenopus laevis	Glucagon	Glucagon-like peptide 1C
NP02448	YAEGTFISDYSIAMDKIRQQDFVNWLLAQKGKKSDWIHNITQ	42	Bos taurus	Glucagon	Gastric inhibitory polypeptide	6391923# Carlquist M., Maletti M., Joernvall H., Mutt V.; # "A novel form of gastric inhibitory polypeptide (GIP) isolated from bovine intestine using a radioreceptor assay. Fragmentation with staphylococcal protease results in GIP1-3 and GIP4-42, fragmentation with enterokinase in GIP1-16 and GIP17-42."; # Eur. J. Biochem. 145:573-577(1984).
NP02449	RSLQNTEEKSSSFPAPQTDPLGDPDQINEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA	69	Bos taurus	Glucagon	Glicentin (By similarity)
NP02450	RSLQNTEEKSSSFPAPQTDPLGDPDQINED	30	Bos taurus	Glucagon	Glicentin-related polypeptide (By similarity)
NP02451	HSQGTFTSDYSKYLDSRRAQDFVQWLMNT	29	Bos taurus	Glucagon	Glucagon	5102927# Bromer W.W., Boucher M.E., Koffenberger J.E. Jr.; # "Amino acid sequence of bovine glucagon."; # J. Biol. Chem. 246:2822-2827(1971).
NP02452	HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG	37	Bos taurus	Glucagon	Glucagon-like peptide 1 (By similarity)
NP02453	HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR	30	Bos taurus	Glucagon	Glucagon-like peptide 1(7-36) (By similarity)
NP02454	HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG	31	Bos taurus	Glucagon	Glucagon-like peptide 1(7-37) (By similarity)
NP02455	HADGSFSDEMNTVLDSLATRDFINWLLQTKITD	33	Bos taurus	Glucagon	Glucagon-like peptide 2 (By similarity)
NP02456	HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA	37	Bos taurus	Glucagon	Oxyntomodulin (By similarity)
NP02457	DVAHGILNKAYRKVLDQPSARRSPADAHGQGLGWDPGGSADDDSEPLS	48	Bos taurus	Glucagon	PACAP-related peptide
NP02458	HSDGIFTDSYSRYRKQMAVKKYLAAVL	27	Bos taurus	Glucagon	Pituitary adenylate cyclase-activating polypeptide 27
NP02459	HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK	38	Bos taurus	Glucagon	Pituitary adenylate cyclase-activating polypeptide 38
NP02460	HSDGTFTSELSRLRDSARLQRLLQGLV	27	Bos taurus	Glucagon	Secretin	7250377# Carlquist M., Joernvall H., Mutt V.; # "Isolation and amino acid sequence of bovine secretin."; # FEBS Lett. 127:71-74(1981).
NP02461	YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL	44	Bos taurus	Glucagon	Somatoliberin	6421287# Esch F., Boehlen P., Ling N., Brazeau P., Guillemin R.; # "Isolation and characterization of the bovine hypothalamic growth hormone releasing factor."; # Biochem. Biophys. Res. Commun. 117:772-779(1983).
NP02462	HADGVFTSDYSRLLGQLSAKKYLESLI	27	Bos taurus	Glucagon	Intestinal peptide PHI-27	6548446# Carlquist M., Kaiser R., Tatemoto K., Joernvall H., Mutt V.; # "A novel form of the polypeptide PHI isolated in high yield from bovine upper intestine. Relationships to other peptides of the glucagon-secretin family."; # Eur. J. Biochem. 144:243-247(1984).
NP02463	HSDAVFTDNYTRLRKQMAVKKYLNSILN	28	Bos taurus	Glucagon	Vasoactive intestinal peptide	520589#Carlquist M., Mutt V., Joernvall H.; #"Isolation and characterization of bovine vasoactive intestinal peptide (VIP)."; #FEBS Lett. 108:457-460(1979).
NP02464	YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ	42	Homo sapiens	Glucagon	Gastric inhibitory polypeptide	6745415# Moody A.J., Thim L., Valverde I.; # "The isolation and sequencing of human gastric inhibitory peptide (GIP)."; # FEBS Lett. 172:142-148(1984).
NP02465	RSLQDTEEKSRSFSASQADPLSDPDQMNEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA	69	Homo sapiens	Glucagon	Glicentin (By similarity)
NP02466	RSLQDTEEKSRSFSASQADPLSDPDQMNED	30	Homo sapiens	Glucagon	Glicentin-related polypeptide (By similarity)
NP02467	HSQGTFTSDYSKYLDSRRAQDFVQWLMNT	29	Homo sapiens	Glucagon	Glucagon	11946536# Thomsen J., Kristiansen K., Brunfeldt K., Sundby F.; # "The amino acid sequence of human glucagon."; # FEBS Lett. 21:315-319(1972).
NP02468	HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG	37	Homo sapiens	Glucagon	Glucagon-like peptide 1
NP02469	HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR	30	Homo sapiens	Glucagon	Glucagon-like peptide 1(7-36)	2753890#Orskov C., Bersani M., Johnsen A.H., Hoejrup P., Holst J.J.; #"Complete sequences of glucagon-like peptide-1 from human and pig small intestine."; #J. Biol. Chem. 264:12826-12829(1989).
NP02470	HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG	31	Homo sapiens	Glucagon	Glucagon-like peptide 1(7-37)
NP02471	HADGSFSDEMNTILDNLAARDFINWLIQTKITD	33	Homo sapiens	Glucagon	Glucagon-like peptide 2 (By similarity)
NP02472	HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA	37	Homo sapiens	Glucagon	Oxyntomodulin (By similarity)
NP02473	DVAHGILNEAYRKVLDQLSAGKHLQSLVARGVGGSLGGGAGDDAEPLS	48	Homo sapiens	Glucagon	PACAP-related peptide
NP02474	HSDGIFTDSYSRYRKQMAVKKYLAAVL	27	Homo sapiens	Glucagon	Pituitary adenylate cyclase-activating polypeptide 27
NP02475	HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK	38	Homo sapiens	Glucagon	Pituitary adenylate cyclase-activating polypeptide 38
NP02476	HSDGTFTSELSRLREGARLQRLLQGLV	27	Homo sapiens	Glucagon	Secretin	# Carlquist M., Joernvall H., Forssmann W.-G., Thulin L., Johansson C., Mutt V.; # "Human secretin is not identical to the porcine/bovine hormone."; # IRCS Med. Sci. 13:217-218(1985).
NP02477	YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL	44	Homo sapiens	Glucagon	Somatoliberin	6812220# Guillemin R., Brazeau P., Boehlen P., Esch F., Ling N., Wehrenberg W.B.; # "Growth hormone-releasing factor from a human pancreatic tumor that caused acromegaly."; # Science 218:585-587(1982).
NP02478	HADGVFTSDFSKLLGQLSAKKYLESLM	27	Homo sapiens	Glucagon	Intestinal peptide PHM-27
NP02479	HADGVFTSDFSKLLGQLSAKKYLESLMGKRVSSNISEDPVPV	42	Homo sapiens	Glucagon	Intestinal peptide PHV-42	3654650# Yiangou Y., di Marzo V., Spokes R.A., Panico M., Morris H.R., Bloom S.R.; # "Isolation, characterization, and pharmacological actions of peptide histidine valine 42, a novel prepro-vasoactive intestinal peptide- derived peptide."; # J. Biol. Chem. 262:14010-14013(1987).
NP02480	HSDAVFTDNYTRLRKQMAVKKYLNSILN	28	Homo sapiens	Glucagon	Vasoactive intestinal peptide
NP02481	HSDAVFTDNYTRLRKQMAVKKYLNSILN	28	Macaca mulatta	Glucagon	Vasoactive intestinal peptide	2003150# Yu J.-H., Xin Y., Eng J., Yalow R.S.; # "Rhesus monkey gastroenteropancreatic hormones: relationship to human sequences."; # Regul. Pept. 32:39-45(1991).
NP02482	MSNSRKMSEPPRFFVGPEDAEINPGNYRRFFHHAEEEEEEEDESPPERQIVVGICSMAKKSKSKPMKEILERISLFKYITVVVFEEEIILNEPVENWPLCDCLISFHSKGFPLDKAVAYAKLRNPFVINDLNMQYLIQDRRDVYSILQAEGILLPRYAILNRDPNNPKECNLIEGEDHVEVNGEVFQKPFVEKPVSAEDHNVYIYYPTSAGGGSQRLFRKIGSRSSVYSPESNVRKTGSYIYEEFMPTDGTDVKVYTVGPDYAHAEARKSPALDGKVERDSEGKEVRYPVILNAREKLIAWKVCLAFKQTVCGFDLLRANGQSYVCDVNGFSFVKNSMKYYDDCAKILGNIVMRELAPQFHIPWSIPLEAEDIPIVPTTSGTMMELRCVIAVIRHGDRTPKQKMKMEVRHQKFFDLFEKCDGYKSGKLKLKKPKQLQEVLDIARQLLMELGQNNDSEIEENKSKLEQLKTVLEMYGHFSGINRKVQLTYLPHGCPKTSSEEEDNRREEPSLLLVLKWGGELTPAGRVQAEELGRAFRCMYPGGQGDYAGFPGCGLLRLHSTYRHDLKIYASDEGRVQMTAAAFAKGLLALEGELTPILVQMVKSANMNGLLDSDSDSLSSCQQRVKARLHEILQKDRDFTAEDYEKLTPSGSISVIKSMHLIKNPVKTCDKVYSLIQSLTSQIRYRMEDPKSADIQLYHSETLELMLRRWSKLEKDFKTKNGRYDISKIPDIYDCIKYDVQHNGSLKLENTMELYRLSKALADIVIPQEYGITKAEKLEIAKGYCTPLVRKIRSDLQRTQDDDTVNKLHPVYSRGVLSPERHVRTRLYFTSESHVHSLLSILRYGALCDDSKDEQWKRAMDYLNVVNELNYMTQIVIMLYEDPNKDLSSEERFHVELHFSPGAKGCEEDKNLPSGYGYRPASRENEGRRSLKTDDDEPHTSKRDEVDRAVMLFKPLVSEPIHIHRKSPLPRSRKITANEVVSENANYLRTPRNLVEQKQNPTVGFELYSMVPSICPLETLHNALFLKQVDDFLASIASPSTEVLRKVPEMSSMATRSSPGMRRKISLNTYTPTKILPTPPAALKSSKASSKAAAGGPSQAMAPHTSSRKKSINSKTEGHEPKKSTGKKR	1129	Mus musculus	Glucagon	Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 2
NP02483	YAEGTFISDYSIAMDKIRQQDFVNWLLAQRGKKSDWKHNITQ	42	Mus musculus	Glucagon	Gastric inhibitory polypeptide
NP02484	HALQDTEENPRSFPASQTEAHEDPDEMNEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA	69	Mus musculus	Glucagon	Glicentin (By similarity)
NP02485	HALQDTEENPRSFPASQTEAHEDPDEMNED	30	Mus musculus	Glucagon	Glicentin-related polypeptide (By similarity)
NP02486	HSQGTFTSDYSKYLDSRRAQDFVQWLMNT	29	Mus musculus	Glucagon	Glucagon (By similarity)
NP02487	HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG	37	Mus musculus	Glucagon	Glucagon-like peptide 1 (By similarity)
NP02488	HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR	30	Mus musculus	Glucagon	Glucagon-like peptide 1(7-36) (By similarity)
NP02489	HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG	31	Mus musculus	Glucagon	Glucagon-like peptide 1(7-37) (By similarity)
NP02490	HADGSFSDEMSTILDNLATRDFINWLIQTKITD	33	Mus musculus	Glucagon	Glucagon-like peptide 2 (By similarity)
NP02491	HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA	37	Mus musculus	Glucagon	Oxyntomodulin (By similarity)
NP02492	DVAHEILNEAYRKVLDQLSARKYLQSVVARGAGENLGGSAVDDPAPLT	48	Mus musculus	Glucagon	PACAP-related peptide
NP02493	HSDGIFTDSYSRYRKQMAVKKYLAAVL	27	Mus musculus	Glucagon	Pituitary adenylate cyclase-activating polypeptide 27
NP02494	HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK	38	Mus musculus	Glucagon	Pituitary adenylate cyclase-activating polypeptide 38
NP02495	HSDGMFTSELSRLQDSARLQRLLQGLV	27	Mus musculus	Glucagon	Secretin (By similarity)
NP02496	HVDAIFTTNYRKLLSQLYARKVIQDIMNKQGERIQEQRARLS	42	Mus musculus	Glucagon	Somatoliberin	1917312#Heimer EP, Ahmad M, Lambros TJ, Felix AM, Downs TR, Frohman LA#Synthesis and biological evaluation of mouse growth hormone-releasing factor#Int J Pept Protein Res 1991 Jun;37(6):552-5
NP02497	HADGVFTSDYSRLLGQISAKKYLESLI	27	Mus musculus	Glucagon	Intestinal peptide PHI-27
NP02498	HADGVFTSDYSRLLGQISAKKYLESLIGKRISSSISEDPVPI	42	Mus musculus	Glucagon	Intestinal peptide PHI-42 (By similarity)
NP02499	HSDAVFTDNYTRLRKQMAVKKYLNSILN	28	Mus musculus	Glucagon	Vasoactive intestinal peptide
NP02500	HAPQDTEENARSFPASQTEPLEDPDQINEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA	69	Rattus norvegicus	Glucagon	Glicentin (By similarity)
NP02501	HAPQDTEENARSFPASQTEPLEDPDQINED	30	Rattus norvegicus	Glucagon	Glicentin-related polypeptide (By similarity)
NP02502	HSQGTFTSDYSKYLDSRRAQDFVQWLMNT	29	Rattus norvegicus	Glucagon	Glucagon (By similarity)
NP02503	HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG	37	Rattus norvegicus	Glucagon	Glucagon-like peptide 1 (By similarity)
NP02504	HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR	30	Rattus norvegicus	Glucagon	Glucagon-like peptide 1(7-36) (By similarity)
NP02505	HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG	31	Rattus norvegicus	Glucagon	Glucagon-like peptide 1(7-37) (By similarity)
NP02506	HADGSFSDEMNTILDNLATRDFINWLIQTKITD	33	Rattus norvegicus	Glucagon	Glucagon-like peptide 2 (By similarity)
NP02507	HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA	37	Rattus norvegicus	Glucagon	Oxyntomodulin	7937770# Collie N.L., Walsh J.H., Wong H.C., Shively J.E., Davis M.T., Lee T.D., Reeve J.R. Jr.; # "Purification and sequence of rat oxyntomodulin."; # Proc. Natl. Acad. Sci. U.S.A. 91:9362-9366(1994).
NP02508	DVAHEILNEAYRKVLDQLSARKYLQSMVARGMGENLAAAAVDDRAPLT	48	Rattus norvegicus	Glucagon	PACAP-related peptide
NP02509	HSDGIFTDSYSRYRKQMAVKKYLAAVL	27	Rattus norvegicus	Glucagon	Pituitary adenylate cyclase-activating polypeptide 27
NP02510	HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK	38	Rattus norvegicus	Glucagon	Pituitary adenylate cyclase-activating polypeptide 38	2803320# Miyata A., Arimura A., Dahl R.R., Minamino N., Uehara A., Jiang A., Culler M.D., Coy D.H.; # "Isolation of a novel 38 residue-hypothalamic polypeptide which stimulates adenylate cyclase in pituitary cells."; # Biochem. Biophys. Res. Commun. 164:567-574(1989).
NP02511	HSDGTFTSELSRLQDSARLQRLLQGLV	27	Rattus norvegicus	Glucagon	Secretin	2719704# Gossen D., Vandermeers A., Vandermeers-Piret M.-C., Rathe J., Cauvin A., Robberecht P., Christophe J.; # "Isolation and primary structure of rat secretin."; # Biochem. Biophys. Res. Commun. 160:862-867(1989).
NP02512	HADAIFTSSYRRILGQLYARKLLHEIMNRQQGERNQEQRSRFN	43	Rattus norvegicus	Glucagon	Somatoliberin	6406907# Spiees J., Rivier J., Vale W.; # "Characterization of rat hypothalamic growth hormone-releasing factor."; # Nature 303:532-535(1983).$6440563#Böhlen P, Wehrenberg WB, Esch F, Ling N, Brazeau P, Guillemin R#Rat hypothalamic growth hormone-releasing factor: isolation, sequence analysis and total synthesis#Biochem Biophys Res Commun 1984 Dec 28;125(3):1005-12
NP02513	HADGVFTSDYSRLLGQISAKKYLESLI	27	Rattus norvegicus	Glucagon	Intestinal peptide PHI-27
NP02514	HADGVFTSDYSRLLGQISAKKYLESLIGKRISSSISEDPVPV	42	Rattus norvegicus	Glucagon	Intestinal peptide PHV-42 (By similarity)
NP02515	HSDAVFTDNYTRLRKQMAVKKYLNSILN	28	Rattus norvegicus	Glucagon	Vasoactive intestinal peptide