Total number of results for Glucagon are 242
Download
as Fasta All
NPID | Sequence | Length | Organism | Family | Name | PMID | Peptide_REF |
---|---|---|---|---|---|---|---|
NP02274 |
YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQGAKVRL
|
42 | Bos taurus | Glucagon | Growth hormone-releasing factor | 6421287#Esch F, Böhlen P, Ling N, Brazeau P, Guillemin R#Isolation and characterization of the bovine hypothalamic growth hormone releasing factor#Biochem Biophys Res Commun 1983 Dec 28;117(3):772-9 | |
NP02275 |
AGAPEPAEPAQPGVY
|
15 | Bos taurus | Glucagon | Proline-rich peptide | 19177842#Galoyan AA, Korochkin LI, Rybalkina EJ, Pavlova GV, Saburina IN, Zaraiski EI, Galoyan NA, Davtyan TK, Bezirganyan KB, Revishchin AV#Hypothalamic proline-rich polypeptide enhances bone marrow colony-forming cell proliferation and stromal progenitor cell differentiation#Cell Transplant 2008;17(9):1061-6 | |
NP02276 |
YADAIFTNSYRKILGQLSARKLLQDIMNRQQERNQEQGAKVRL
|
43 | Capra hircus | Glucagon | Growth hormone-releasing factor | 6440561#Brazeau P, Böhlen P, Esch F, Ling N, Wehrenberg WB, Guillemin R#Growth hormone-releasing factor from ovine and caprine hypothalamus: isolation, sequence analysis and total synthesis#Biochem Biophys Res Commun 1984 Dec 14;125(2):606-14 | |
NP02277 |
HSDAVFTDNYSRYRKQMAAKKYLNSVLA
|
28 | Carassius auratus | Glucagon | vasoactive intestinal peptide | 8536941#Uesaka T, Yano K, Yamasaki M, Ando M#Somatostatin-, vasoactive intestinal peptide-, and granulin-like peptides isolated from intestinal extracts of goldfish, Carassius auratus#Gen Comp Endocrinol 1995 Sep;99(3):298-306 | |
NP02278 |
HSQGTFTSDYSKHLDSRYAQEFVQWLMNT
|
29 | Chinchilla | Glucagon | glucagon | 2235678#Eng J, Kleinman WA, Chu LS#Purification of peptide hormones from chinchilla pancreas by chemical assay#Peptides 1990 Jul-Aug;11(4):683-5 | |
NP02279 |
YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL
|
44 | NA | Glucagon | Growth hormone-releasing factor | 6418166#Böhlen P, Esch F, Brazeau P, Ling N, Guillemin R#Isolation and characterization of the porcine hypothalamic growth hormone releasing factor#Biochem Biophys Res Commun 1983 Oct 31;116(2):726-34 | |
NP02280 |
HADGVFTSDFSRLLGQLSAKKYLESLI
|
27 | NA | Glucagon | Peptide HI | 6947244#Tatemoto K, Mutt V#Isolation and characterization of the intestinal peptide porcine PHI (PHI-27), a new member of the glucagon--secretin family#Proc Natl Acad Sci U S A 1981 Nov;78(11):6603-7 | |
NP02281 |
HAEGTFTSDMTSYLEEKAAKEFVDWLIKGRPK
|
32 | Pyxicephalus adspersus | Glucagon | Glucagon-like peptide 1 | 10882553#Conlon JM, White AM, Platz JE#Islet hormones from the African bullfrog Pyxicephalus adspersus (Anura:Ranidae): structural characterization and phylogenetic implications#Gen Comp Endocrinol 2000 Jul;119(1):85-94 | |
NP02282 |
HIDGIFTDSYSRY
|
13 | Coturnix coturnix japonica | Glucagon | PACAP27 | 20298575#Scholz B, Alm H, Mattsson A, Nilsson A, Kultima K, Savitski MM, Fälth M, Sköld K, Brunström B, Andren PE, Dencker L#Neuropeptidomic analysis of the embryonic Japanese quail diencephalon#BMC Dev Biol 2010 Mar 18;10:30 | |
NP02283 |
AVFTDNYSRF
|
10 | Coturnix coturnix japonica | Glucagon | vasoactive intestinal peptide | 20298575#Scholz B, Alm H, Mattsson A, Nilsson A, Kultima K, Savitski MM, Fälth M, Sköld K, Brunström B, Andren PE, Dencker L#Neuropeptidomic analysis of the embryonic Japanese quail diencephalon#BMC Dev Biol 2010 Mar 18;10:30 | |
NP02284 |
HSDGTFTSELSRLRESARLQRLLQGLV
|
27 | Canis familiaris | Glucagon | Secretin | 3626755#Shinomura Y, Eng J, Yalow RS#Dog secretin: sequence and biologic activity#Life Sci 1987 Sep 7;41(10):1243-8 | |
NP02285 |
HADGMFNKAYRKALGQLSARKYLHTLMAKRVGGGSMIEDDNEPLS
|
45 | Cyprinus carpio | Glucagon | Somatoliberin | 1475012#Vaughan JM, Rivier J, Spiess J, Peng C, Chang JP, Peter RE, Vale W#Isolation and characterization of hypothalamic growth-hormone releasing factor from common carp, Cyprinus carpio#Neuroendocrinology 1992 Oct;56(4):539-49 | |
NP02286 |
HSDGLFTSEYSKMRGNAQVQKFIQNLM
|
27 | Gallus gallus | Glucagon | Secretin | 7460928#Nilsson A, Carlquist M, Jörnvall H, Mutt V#Isolation and characterization of chicken secretin#Eur J Biochem 1980 Nov;112(2):383-8 | |
NP02287 |
HSDAVFTDNYSRIRKQMAVKKYINSLLA
|
28 | Scyliorhinus canicula | Glucagon | vasoactive intestinal peptide | 2441759#Dimaline R, Young J, Thwaites DT, Lee CM, Shuttleworth TJ, Thorndyke MC#A novel vasoactive intestinal peptide (VIP) from elasmobranch intestine has full affinity for mammalian pancreatic VIP receptors#Biochim Biophys Acta 1987 Aug 19;930(1):97-100 $#Dimaline R., Young J., Thwaites D.T., Lee C.M., Thorndyke M.C.#Amino acid sequence of a biologically active vasoactive intestinal peptide from the elasmobranch Scyliorhinus canicula.#Ann. N. Y. Acad. Sci. 527:621-623(1988). | |
NP02288 |
HSQGTFTSDYSKYLDTRRAQDFVQWLMST
|
29 | Alligator mississippiensis | Glucagon | Glucagon | ||
NP02289 |
HSDAVFTDNYSRFRKQMAVKKYLNSVLT
|
28 | Alligator mississippiensis | Glucagon | Vasoactive intestinal peptide | 8101369#Wang Y., Conlon J.M.#Neuroendocrine peptides (NPY, GRP, VIP, somatostatin) from the brain and stomach of the alligator.# Peptides 14:573-579(1993). | |
NP02290 |
HSQGTFTSDYSKYLDTRRAQDFVQWLMST
|
29 | Anas platyrhynchos | Glucagon | Glucagon | 4636745#Sundby F., Frandsen E.K., Thomsen J., Kristiansen K., Brunfeldt K.#Crystallization and amino acid sequence of duck glucagon.# FEBS Lett. 26:289-293(1972). | |
NP02291 |
HSQGTFTNDYSKYLDTRRAQDFVQWLMSTKRSGGIT
|
36 | Atractosteus spatula | Glucagon | Glucagon-36 | 3282974#Pollock H.G., Kimmel J.R., Ebner K.E., Hamilton J.W., Rouse J.B., Lance V., Rawitch A.B.#Isolation of alligator gar (Lepisosteus spatula) glucagon, oxyntomodulin, and glucagon-like peptide: amino acid sequences of oxyntomodulin and glucagon-like peptide.# Gen. Comp. Endocrinol. 69:133-140(1988). | |
NP02292 |
HSQGTFTNDYSKYLDTRRAQDFVQWLMST
|
29 | Atractosteus spatula | Glucagon | Glucagon | 3311873#Pollock H.G., Kimmel J.R., Hamilton J.W., Rouse J.B., Ebner K.E., Lance V., Rawitch A.B.#Isolation and structures of alligator gar (Lepisosteus spatula) insulin and pancreatic polypeptide.#Gen. Comp. Endocrinol. 67:375-382(1987). | |
NP02293 |
HADGTYTSDVSSYLQDQAAKKFVTWLKQGQDRRE
|
34 | Atractosteus spatula | Glucagon | Glucagon-like peptide | 3282974#Pollock H.G., Kimmel J.R., Ebner K.E., Hamilton J.W., Rouse J.B., Lance V., Rawitch A.B.#Isolation of alligator gar (Lepisosteus spatula) glucagon, oxyntomodulin, and glucagon-like peptide: amino acid sequences of oxyntomodulin and glucagon-like peptide.# Gen. Comp. Endocrinol. 69:133-140(1988). | |
NP02294 |
HSEGTFSSDYSKYLDSRRAKDFVQWLMST
|
29 | Callorhynchus milii | Glucagon | Glucagon | 2690815#Berks B.C., Marshall C.J., Carne A., Galloway S.M., Cutfield J.F.#Isolation and structural characterization of insulin and glucagon from the holocephalan species Callorhynchus milii (elephantfish).# Biochem. J. 263:261-266(1989). | |
NP02295 |
HSQGTFTSDYSKYLDSRRAQDFVQWLMNT
|
29 | Camelus dromedarius | Glucagon | Glucagon | 4421675#Sundby F., Markussen J., Danho W.#Camel glucagon: isolation, crystallization and amino acid composition.# Horm. Metab. Res. 6:425-425(1974). | |
NP02296 |
RSLQDTEEKSRSFSAPQTEPLNDLDQMNEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA
|
69 | Canis familiaris | Glucagon | Glicentin | 3238052#Shinomura Y., Eng J., Yalow R.S.#Immunoreactive glucagons purified from dog pancreas, stomach and ileum.# Regul. Pept. 23:299-308(1988). | |
NP02297 |
RSLQDTEEKSRSFSAPQTEPLNDLDQMNED
|
30 | Canis familiaris | Glucagon | Glicentin-related polypeptide (By similarity) | ||
NP02298 |
HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA
|
37 | Canis familiaris | Glucagon | Oxyntomodulin (By similarity) | ||
NP02299 |
HSQGTFTSDYSKYLDSRRAQDFVQWLMNT
|
29 | Canis familiaris | Glucagon | Glucagon (By similarity) | ||
NP02300 |
HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
|
37 | Canis familiaris | Glucagon | Glucagon-like peptide 1 | ||
NP02301 |
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
|
31 | Canis familiaris | Glucagon | Glucagon-like peptide 1(7-37) | ||
NP02302 |
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR
|
30 | Canis familiaris | Glucagon | Glucagon-like peptide 1(7-36) | ||
NP02303 |
HADGSFSDEMNTVLDTLATRDFINWLLQTKITD
|
33 | Canis familiaris | Glucagon | Glucagon-like peptide 2 (By similarity) | ||
NP02304 |
HSDAVFTDNYTRLRKQMAVKKYLNSILN
|
28 | Canis familiaris | Glucagon | Vasoactive intestinal peptide | 3748846#Eng J., Du B.-H., Raufman J.-P., Yalow R.S.#Purification and amino acid sequences of dog, goat and guinea pig VIPs.# Peptides 7 Suppl. 1:17-20(1986). | |
NP02305 |
YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL
|
44 | Capra hircus | Glucagon | Somatoliberin | 6440561#Brazeau P., Boehlen P., Esch F., Ling N., Wehrenberg W.B., Guillemin R.#Growth hormone-releasing factor from ovine and caprine hypothalamus: isolation, sequence analysis and total synthesis.# Biochem. Biophys. Res. Commun. 125:606-614(1984). | |
NP02306 |
HSDAVFTDNYTRLRKQMAVKKYLNSILN
|
28 | Capra hircus | Glucagon | Vasoactive intestinal peptide | 3748846#Eng J., Du B.-H., Raufman J.-P., Yalow R.S.#Purification and amino acid sequences of dog, goat and guinea pig VIPs.# Peptides 7 Suppl. 1:17-20(1986). | |
NP02307 |
VPLQDYHTSTETVEGLLARGQGFTTA
|
26 | Carassius auratus | Glucagon | Glicentin-related polypeptide (By similarity) | ||
NP02308 |
HSEGTFSNDYSKYLETRRAQDFVEWLMNS
|
29 | Carassius auratus | Glucagon | Glucagon (By similarity) | ||
NP02309 |
HAEGTYTSDISSFLRDQAAQNFVAWLKSGQPKQE
|
34 | Carassius auratus | Glucagon | Glucagon-like peptide (By similarity) | ||
NP02310 |
RSLQDTEEKPRSVSASQTDMLDDPDQMNEDKRHSQGTFTSDYSKYLDSRRAQQFLKWLLNVKRNRNNIA
|
69 | Cavia porcellus | Glucagon | Glicentin (By similarity) | ||
NP02311 |
RSLQDTEEKPRSVSASQTDMLDDPDQMNED
|
30 | Cavia porcellus | Glucagon | Glicentin-related polypeptide (By similarity) | ||
NP02312 |
HSQGTFTSDYSKYLDSRRAQQFLKWLLNVKRNRNNIA
|
37 | Cavia porcellus | Glucagon | Oxyntomodulin | 4048553#Conlon J.M., Hansen H.F., Schwartz T.W.#Primary structure of glucagon and a partial sequence of oxyntomodulin (glucagon-37) from the guinea pig.#Regul. Pept. 11:309-320(1985). | |
NP02313 |
HSQGTFTSDYSKYLDSRRAQQFLKWLLNV
|
29 | Cavia porcellus | Glucagon | Glucagon | 3956884#Huang C.G., Eng J., Pan Y.-C.E., Hulmes J.D., Yalow R.S.#Guinea pig glucagon differs from other mammalian glucagons.# Diabetes 35:508-512(1986). | |
NP02314 |
HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
|
37 | Cavia porcellus | Glucagon | Glucagon-like peptide 1 (By similarity) | ||
NP02315 |
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
|
31 | Cavia porcellus | Glucagon | Glucagon-like peptide 1(7-37) (By similarity) | ||
NP02316 |
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR
|
30 | Cavia porcellus | Glucagon | Glucagon-like peptide 1(7-36) (By similarity) | ||
NP02317 |
HADGSFSDEMNTILDNLATRDFINWLIQTKITD
|
33 | Cavia porcellus | Glucagon | Glucagon-like peptide 2 (By similarity) | ||
NP02318 |
HSDGTFTSELSRLRDSARLQRLLQGLV
|
27 | Cavia porcellus | Glucagon | Secretin | 2340294#Buscail L., Cauvin A., Gourlet P., Gossen D., de Neef P., Rathe J., Robberecht P., Vandermeers-Piret M.-C., Vandermeers A., Christophe J.#Purification and amino acid sequence of vasoactive intestinal peptide, peptide histidine isoleucinamide (1-27) and secretin from the small intestine of guinea pig.# Biochim. Biophys. Acta 1038:355-359(1990). | |
NP02319 |
HADGVFTSDYSRLLGQLSARKYLESLI
|
27 | Cavia porcellus | Glucagon | Intestinal peptide PHI-27 | 2340294#Buscail L., Cauvin A., Gourlet P., Gossen D., de Neef P., Rathe J., Robberecht P., Vandermeers-Piret M.-C., Vandermeers A., Christophe J.#Purification and amino acid sequence of vasoactive intestinal peptide, peptide histidine isoleucinamide (1-27) and secretin from the small intestine of guinea pig.# Biochim. Biophys. Acta 1038:355-359(1990). | |
NP02320 |
HSDALFTDTYTRLRKQMAMKKYLNSVLN
|
28 | Cavia porcellus | Glucagon | Vasoactive intestinal peptide | 2340294#Buscail L., Cauvin A., Gourlet P., Gossen D., de Neef P., Rathe J., Robberecht P., Vandermeers-Piret M.-C., Vandermeers A., Christophe J.#Purification and amino acid sequence of vasoactive intestinal peptide, peptide histidine isoleucinamide (1-27) and secretin from the small intestine of guinea pig.# Biochim. Biophys. Acta 1038:355-359(1990).$3748846#Eng J., Du B.-H., Raufman J.-P., Yalow R.S.#Purification and amino acid sequences of dog, goat and guinea pig VIPs.#Peptides 7 Suppl. 1:17-20(1986).$4004849#Du B.-H., Eng J., Hulmes J.D., Chang M., Pan Y.-C.E., Yalow R.S.#Guinea pig has a unique mammalian VIP.#Biochem. Biophys. Res. Commun. 128:1093-1098(1985). | |
NP02321 |
HADGLLDRALRDILVQLSARKYLHSLTAVRVGEEEEDEEDSEPLS
|
45 | Clarias macrocephalus | Glucagon | Growth hormone-releasing factor | ||
NP02322 |
HSDGIFTDSYSRYRKQMAVKKYLAAVLGRRYRQRFRNK
|
38 | Clarias macrocephalus | Glucagon | Pituitary adenylate cyclase-activating polypeptide | ||
NP02323 |
HSQGTFTSDYSKYLDSRRAQDFVQWLMST
|
29 | Didelphis virginiana | Glucagon | Glucagon | 2695899#Yu J.-H., Eng J., Rattan S., Yalow R.S.#Opossum insulin, glucagon and pancreatic polypeptide: amino acid sequences.# Peptides 10:1195-1197(1989). | |
NP02324 |
HSDAVFTDNYSRFRKQMAAKKYLNS
|
25 | Gadus morhua | Glucagon | Vasoactive intestinal peptide | #Thwaites D.T., Young J., Thorndyke M.C., Dimaline R.#Isolation and characterisation of two teleost VIP's.# Regul. Pept. 21:436-436(1988). | |
NP02325 |
NPLQDTEEKSRSFKASQSEPLDESRQLNEV
|
30 | Gallus gallus | Glucagon | Glicentin-related polypeptide (By similarity) | ||
NP02326 |
HSQGTFTSDYSKYLDSRRAQDFVQWLMST
|
29 | Gallus gallus | Glucagon | Glucagon | 1194290#Pollock H.G., Kimmel J.R.#Chicken glucagon. Isolation and amino acid sequence studies.# J. Biol. Chem. 250:9377-9380(1975).$2828209#Huang J., Eng J., Yalow R.S.#Chicken glucagon: sequence and potency in receptor assay.#Horm. Metab. Res. 19:542-544(1987). | |
NP02327 |
HSEFERHAEGTYTSDITSYLEGQAAKEFIAWLVNGRG
|
37 | Gallus gallus | Glucagon | Glucagon-like peptide 1 (By similarity) | ||
NP02328 |
HAEGTYTSDITSYLEGQAAKEFIAWLVNGRG
|
31 | Gallus gallus | Glucagon | Glucagon-like peptide 1(7-37) (By similarity) | ||
NP02329 |
HAEGTYTSDITSYLEGQAAKEFIAWLVNGR
|
30 | Gallus gallus | Glucagon | Glucagon-like peptide 1(7-36) (By similarity) | ||
NP02330 |
HADGTFTSDINKILDDMAAKEFLKWLINTKVTQ
|
33 | Gallus gallus | Glucagon | Glucagon-like peptide 2 (By similarity) | ||
NP02331 |
HADGIFSKAYRKLLGQLSARNYLHSLMAKRVGGASSGLGDEAEPLS
|
46 | Gallus gallus | Glucagon | Growth hormone-releasing factor 1-46 | ||
NP02332 |
HIDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK
|
38 | Gallus gallus | Glucagon | Pituitary adenylate cyclase-activating polypeptide 38 | #Yasuhara T., Mizuno K., Somogyvari-Vigh A., Komaki G., Arimura A.#Isolation and primary structure of chicken PACAP.# Regul. Pept. 37:326-326(1992). | |
NP02333 |
HIDGIFTDSYSRYRKQMAVKKYLAAVL
|
27 | Gallus gallus | Glucagon | Pituitary adenylate cyclase-activating polypeptide 27 | #Yasuhara T., Mizuno K., Somogyvari-Vigh A., Komaki G., Arimura A.#Isolation and primary structure of chicken PACAP.# Regul. Pept. 37:326-326(1992). | |
NP02334 |
HADGIFTSVYSHLLAKLAVKRYLHSLI
|
27 | Gallus gallus | Glucagon | Intestinal peptide PHI-27-like | ||
NP02335 |
HSDAVFTDNYSRFRKQMAVKKYLNSVLT
|
28 | Gallus gallus | Glucagon | Vasoactive intestinal peptide | 1227973#Nilsson A.#Structure of the vasoactive intestinal octacosapeptide from chicken intestine. The amino acid sequence.# FEBS Lett. 60:322-326(1975).$#Bodanszky M., Lin C.Y., Yiotakis A.E., Mutt V., Said S.I.#Vasoactive intestinal peptide (VIP) from chicken. Synthesis and properties of the C-terminal hendecapeptide.#Bioorg. Chem. 5:339-350(1976). | |
NP02336 |
SPLQETEEKSRSFKASQAEPLDDSRQLNEV
|
30 | Heloderma suspectum | Glucagon | Glicentin-related polypeptide (By similarity) | ||
NP02337 |
HSQGTFTSDYSKYLDTRRAQDFVQWLMNT
|
29 | Heloderma suspectum | Glucagon | Glucagon (By similarity) | ||
NP02338 |
HAEYERHADGRYTSDISSYLEGQAAKEFIAWLVNGRG
|
37 | Heloderma suspectum | Glucagon | Glucagon-like peptide 1 (By similarity) | ||
NP02339 |
HADGRYTSDISSYLEGQAAKEFIAWLVNGRG
|
31 | Heloderma suspectum | Glucagon | Glucagon-like peptide 1(7-37) (By similarity) | ||
NP02340 |
HADGRYTSDISSYLEGQAAKEFIAWLVNGR
|
30 | Heloderma suspectum | Glucagon | Glucagon-like peptide 1(7-36) (By similarity) | ||
NP02341 |
HADGTFTSDYNQLLDDIATQEFLKWLINQKVTQ
|
33 | Heloderma suspectum | Glucagon | Glucagon-like peptide 2 (By similarity) | ||
NP02342 |
IFNKAYRKVLGQLSARKYLHSLM
|
23 | Heloderma suspectum | Glucagon | PACAP-related peptide | ||
NP02343 |
HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQ
|
33 | Heloderma suspectum | Glucagon | Pituitary adenylate cyclase-activating polypeptide 38 | ||
NP02344 |
HSDGIFTDSYSRYRKQMAVKKYLAAVL
|
27 | Heloderma suspectum | Glucagon | Pituitary adenylate cyclase-activating polypeptide 27 | ||
NP02345 |
HSEGTFSNDYSKYLETRRAQDFVQWLMNS
|
29 | Ictalurus punctatus | Glucagon | Glucagon | 3030323#Hoosein N.M., Mahrenholz A.M., Andrews P.C., Gurd R.S.#Biological activities of catfish glucagon and glucagon-like peptide.# Biochem. Biophys. Res. Commun. 143:87-92(1987).$3838546#Andrews P.C., Ronner P.#Isolation and structures of glucagon and glucagon-like peptide from catfish pancreas.#J. Biol. Chem. 260:3910-3914(1985). | |
NP02346 |
HADGTYTSDVSSYLQEQAAKDFITWLKSGQPKPE
|
34 | Ictalurus punctatus | Glucagon | Glucagon-like peptide | 3030323#Hoosein N.M., Mahrenholz A.M., Andrews P.C., Gurd R.S.#Biological activities of catfish glucagon and glucagon-like peptide.# Biochem. Biophys. Res. Commun. 143:87-92(1987).$3838546#Andrews P.C., Ronner P.#Isolation and structures of glucagon and glucagon-like peptide from catfish pancreas.#J. Biol. Chem. 260:3910-3914(1985). | |
NP02347 |
HSQGTFTSDYSKYLDSRRAQDFVQWLMNSKRSGGIS
|
36 | Lithobates catesbeiana | Glucagon | Glucagon-36 | 3260236#Pollock H.G., Hamilton J.W., Rouse J.B., Ebner K.E., Rawitch A.B.#Isolation of peptide hormones from the pancreas of the bullfrog (Rana catesbeiana). Amino acid sequences of pancreatic polypeptide, oxyntomodulin, and two glucagon-like peptides.# J. Biol. Chem. 263:9746-9751(1988). | |
NP02348 |
HSQGTFTSDYSKYLDSRRAQDFVQWLMNS
|
29 | Lithobates catesbeiana | Glucagon | Glucagon | 3260236#Pollock H.G., Hamilton J.W., Rouse J.B., Ebner K.E., Rawitch A.B.#Isolation of peptide hormones from the pancreas of the bullfrog (Rana catesbeiana). Amino acid sequences of pancreatic polypeptide, oxyntomodulin, and two glucagon-like peptides.# J. Biol. Chem. 263:9746-9751(1988). | |
NP02349 |
HADGTFTSDMSSYLEEKAAKEFVDWLIKGRPK
|
32 | Lithobates catesbeiana | Glucagon | Glucagon-like peptide 1 | 3260236#Pollock H.G., Hamilton J.W., Rouse J.B., Ebner K.E., Rawitch A.B.#Isolation of peptide hormones from the pancreas of the bullfrog (Rana catesbeiana). Amino acid sequences of pancreatic polypeptide, oxyntomodulin, and two glucagon-like peptides.# J. Biol. Chem. 263:9746-9751(1988). | |
NP02350 |
HADGSFTSDFNKALDIKAAQEFLDWIINTPVKE
|
33 | Lithobates catesbeiana | Glucagon | Glucagon-like peptide 2 | 3260236#Pollock H.G., Hamilton J.W., Rouse J.B., Ebner K.E., Rawitch A.B.#Isolation of peptide hormones from the pancreas of the bullfrog (Rana catesbeiana). Amino acid sequences of pancreatic polypeptide, oxyntomodulin, and two glucagon-like peptides.# J. Biol. Chem. 263:9746-9751(1988). | |
NP02351 |
QEADPSSSLEADSTLKDEPRELSNM
|
25 | Lophius americanus | Glucagon | Glicentin-related polypeptide (By similarity) | ||
NP02352 |
HSEGTFSNDYSKYLEDRKAQEFVRWLMNN
|
29 | Lophius americanus | Glucagon | Glucagon-1 | 3058456#Nichols R., Lee T.D., Andrews P.C.#Pancreatic proglucagon processing: isolation and structures of glucagon and glucagon-like peptide from gene I.# Endocrinology 123:2639-2645(1988). | |
NP02353 |
HADGTFTSDVSSYLKDQAIKDFVDRLKAGQVRRE
|
34 | Lophius americanus | Glucagon | Glucagon-like peptide 1 (By similarity) | 3058456#Nichols R., Lee T.D., Andrews P.C.#Pancreatic proglucagon processing: isolation and structures of glucagon and glucagon-like peptide from gene I.# Endocrinology 123:2639-2645(1988). | |
NP02354 |
MPDQDPDRNSMLLNENSMLTEPIEPLNM
|
28 | Lophius americanus | Glucagon | Glicentin-related polypeptide | ||
NP02355 |
HSEGTFSNDYSKYLETRRAQDFVQWLKNS
|
29 | Lophius americanus | Glucagon | Glucagon-2 | ||
NP02356 |
HADGTYTSDVSSYLQDQAAKDFVSWLKAGRG
|
31 | Lophius americanus | Glucagon | Glucagon-like peptide 2 | ||
NP02357 |
HSQGTFTSDYSKYLDSRRAQDFVQWLMST
|
29 | Meleagris gallopavo | Glucagon | Glucagon | 4645932#Markussen J., Frandsen E.K., Heding L.G., Sundby F.#Turkey glucagon: crystallization, amino acid composition and immunology.# Horm. Metab. Res. 4:360-363(1972). | |
NP02358 |
HADGIFTTVYSHLLAKLAVKRYLHSLI
|
27 | Meleagris gallopavo | Glucagon | Intestinal peptide PHI-27-like | ||
NP02359 |
HSDAVFTDNYSRFRKQMAVKKYLNSVLT
|
28 | Meleagris gallopavo | Glucagon | Vasoactive intestinal peptide | ||
NP02360 |
HSLQDTEEKSRSFPASQTDPLEDPDQINEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA
|
69 | Mesocricetus auratus | Glucagon | Glicentin (By similarity) | ||
NP02361 |
HSLQDTEEKSRSFPASQTDPLEDPDQINED
|
30 | Mesocricetus auratus | Glucagon | Glicentin-related polypeptide (By similarity) | ||
NP02362 |
HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA
|
37 | Mesocricetus auratus | Glucagon | Oxyntomodulin (By similarity) | ||
NP02363 |
HSQGTFTSDYSKYLDSRRAQDFVQWLMNT
|
29 | Mesocricetus auratus | Glucagon | Glucagon (By similarity) | ||
NP02364 |
HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
|
37 | Mesocricetus auratus | Glucagon | Glucagon-like peptide 1 (By similarity) | ||
NP02365 |
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
|
31 | Mesocricetus auratus | Glucagon | Glucagon-like peptide 1(7-37) (By similarity) | ||
NP02366 |
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR
|
30 | Mesocricetus auratus | Glucagon | Glucagon-like peptide 1(7-36) (By similarity) | ||
NP02367 |
HADGSFSDEMNTILDSLATRDFINWLIQTKITD
|
33 | Mesocricetus auratus | Glucagon | Glucagon-like peptide 2 (By similarity) | ||
NP02368 |
YADAIFTSSYRKVLGQLSARKLLQDIMSRQQGERNQEQGPRVRL
|
44 | Mesocricetus auratus | Glucagon | Somatoliberin | ||
NP02369 |
LQDAEDSSRFDADDTLAGEARELSTP
|
26 | Myoxocephalus scorpius | Glucagon | Glicentin-related polypeptide | 3549298#Conlon J.M., Falkmer S., Thim L.#Primary structures of three fragments of proglucagon from the pancreatic islets of the daddy Sculpin (Cottus scorpius).# Eur. J. Biochem. 164:117-122(1987). | |
NP02370 |
HSEGTFSNDYSKYLETRRAQDFVQWLKNS
|
29 | Myoxocephalus scorpius | Glucagon | Glucagon | 3549298#Conlon J.M., Falkmer S., Thim L.#Primary structures of three fragments of proglucagon from the pancreatic islets of the daddy Sculpin (Cottus scorpius).# Eur. J. Biochem. 164:117-122(1987). | |
NP02371 |
HADGTFTSDVSSYLNDQAIKDFVAKLKSGKV
|
31 | Myoxocephalus scorpius | Glucagon | Glucagon-like peptide | 3549298#Conlon J.M., Falkmer S., Thim L.#Primary structures of three fragments of proglucagon from the pancreatic islets of the daddy Sculpin (Cottus scorpius).# Eur. J. Biochem. 164:117-122(1987). | |
NP02372 |
HPLQDTEEKPRSFSTSQTDLLDDPDQMNEDKRHSQGTFTSDYSKFLDTRRAQDFLDWLKNTKRNRNEIA
|
69 | Octodon degus | Glucagon | Glicentin (By similarity) | ||
NP02373 |
HPLQDTEEKPRSFSTSQTDLLDDPDQMNED
|
30 | Octodon degus | Glucagon | Glicentin-related polypeptide (By similarity) | ||
NP02374 |
HSQGTFTSDYSKFLDTRRAQDFLDWLKNTKRNRNEIA
|
37 | Octodon degus | Glucagon | Oxyntomodulin (By similarity) | ||
NP02375 |
HSQGTFTSDYSKFLDTRRAQDFLDWLKNT
|
29 | Octodon degus | Glucagon | Glucagon (By similarity) | ||
NP02376 |
HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
|
37 | Octodon degus | Glucagon | Glucagon-like peptide 1 (By similarity) | ||
NP02377 |
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
|
31 | Octodon degus | Glucagon | Glucagon-like peptide 1(7-37) (By similarity) | ||
NP02378 |
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR
|
30 | Octodon degus | Glucagon | Glucagon-like peptide 1(7-36) (By similarity) | ||
NP02379 |
HADGSFSDEMNTVLDHLATKDFINWLIQTKITD
|
33 | Octodon degus | Glucagon | Glucagon-like peptide 2 (By similarity) | ||
NP02380 |
HSEGTFSNDYSKYQEERMAQDFVQWLMNS
|
29 | Oncorhynchus kisutch | Glucagon | Glucagon-1 | 3520699#Plisetskaya E., Pollock H.G., Rouse J.B., Hamilton J.W., Kimmel J.R., Gorbman A.#Isolation and structures of coho salmon (Oncorhynchus kisutch) glucagon and glucagon-like peptide.# Regul. Pept. 14:57-67(1986). | |
NP02381 |
HADGTYTSNVSTYLQDQAAKDFVSWLKSGRA
|
31 | Oncorhynchus kisutch | Glucagon | Glucagon-like peptide 1-1 | 3520699#Plisetskaya E., Pollock H.G., Rouse J.B., Hamilton J.W., Kimmel J.R., Gorbman A.#Isolation and structures of coho salmon (Oncorhynchus kisutch) glucagon and glucagon-like peptide.# Regul. Pept. 14:57-67(1986). | |
NP02382 |
SPLQEAEDNSSLETTDPLLEDLMGVSNV
|
28 | Oncorhynchus mykiss | Glucagon | Glicentin-related polypeptide 1 | ||
NP02383 |
HSEGTFSNDYSKYQEERMAQDFVQWLMNS
|
29 | Oncorhynchus mykiss | Glucagon | Glucagon-1 | ||
NP02384 |
HADGTYTSDVSTYLQDQAAKDFVSWLKSGRA
|
31 | Oncorhynchus mykiss | Glucagon | Glucagon-like peptide 1-1 (By similarity) | ||
NP02385 |
HVDGSFTSDVNKVLDSLAAKEYLLWVMTSKTSG
|
33 | Oncorhynchus mykiss | Glucagon | Glucagon-like peptide 2 | ||
NP02386 |
SPLQEAEDNSSLETADSLLEDLRGVPNM
|
28 | Oncorhynchus mykiss | Glucagon | Glicentin-related polypeptide 2 | ||
NP02387 |
QSEGTFSNYYSKYQEERMARDFLHWLMNS
|
29 | Oncorhynchus mykiss | Glucagon | Glucagon-2 | ||
NP02388 |
HADGTYTSDVSTYLQDQAAKDFVSWLKSGPA
|
31 | Oncorhynchus mykiss | Glucagon | Glucagon-like peptide 1-2 | ||
NP02389 |
HADGMFNKAYRKALGQLSARKYLHSLMAKRVGGGSTMEDDTEPLS
|
45 | Oncorhynchus nerka | Glucagon | Growth hormone-releasing factor | ||
NP02390 |
HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYRQRYRNK
|
38 | Oncorhynchus nerka | Glucagon | Pituitary adenylate cyclase-activating polypeptide | ||
NP02391 |
HSQGTFTSDYSKYLDSRRAQDFVQWLMNT
|
29 | Oryctolagus cuniculus | Glucagon | Glucagon | 5011077#Sundby F., Markussen J.#Rabbit glucagon: isolation, crystallization and amino acid composition.# Horm. Metab. Res. 4:56-56(1972). | |
NP02392 |
HADGVFTSDFSRLLGQLSAKKYLESLI
|
27 | Oryctolagus cuniculus | Glucagon | Intestinal peptide PHI-27 | 2342988#Gossen D., Buscail L., Cauvin A., Gourlet P., de Neef P., Rathe J., Robberecht P., Vandermeers-Piret M.C., Vandermeers A., Christophe J.#Amino acid sequence of VIP, PHI and secretin from the rabbit small intestine.# Peptides 11:123-128(1990). | |
NP02393 |
HSDAVFTDNYTRLRKQMAVKKYLNSILN
|
28 | Oryctolagus cuniculus | Glucagon | Vasoactive intestinal peptide | 2342988#Gossen D., Buscail L., Cauvin A., Gourlet P., de Neef P., Rathe J., Robberecht P., Vandermeers-Piret M.C., Vandermeers A., Christophe J.#Amino acid sequence of VIP, PHI and secretin from the rabbit small intestine.# Peptides 11:123-128(1990). | |
NP02394 |
HSLQNTEEKSSSFPAPQTDPLGDPDQISEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA
|
69 | Ovis aries | Glucagon | Glicentin (By similarity) | ||
NP02395 |
HSLQNTEEKSSSFPAPQTDPLGDPDQISED
|
30 | Ovis aries | Glucagon | Glicentin-related polypeptide (By similarity) | ||
NP02396 |
HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA
|
37 | Ovis aries | Glucagon | Oxyntomodulin (By similarity) | ||
NP02397 |
HSQGTFTSDYSKYLDSRRAQDFVQWLMNT
|
29 | Ovis aries | Glucagon | Glucagon | ||
NP02398 |
HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
|
37 | Ovis aries | Glucagon | Glucagon-like peptide 1 (By similarity) | ||
NP02399 |
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
|
31 | Ovis aries | Glucagon | Glucagon-like peptide 1(7-37) (By similarity) | ||
NP02400 |
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR
|
30 | Ovis aries | Glucagon | Glucagon-like peptide 1(7-36) (By similarity) | ||
NP02401 |
HADGSFSDEMNTVLDSLATRDFINWLLQTKI
|
31 | Ovis aries | Glucagon | Glucagon-like peptide 2 (By similarity) | ||
NP02402 |
DVAHGILDKAYRKVLDQLSARRYLQTLMAKGLGGTPGGGADDDSEPLS
|
48 | Ovis aries | Glucagon | PACAP-related peptide | ||
NP02403 |
HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK
|
38 | Ovis aries | Glucagon | Pituitary adenylate cyclase-activating polypeptide 38 | ||
NP02404 |
HSDGIFTDSYSRYRKQMAVKKYLAAVL
|
27 | Ovis aries | Glucagon | Pituitary adenylate cyclase-activating polypeptide 27 | 2383262#Miyata A., Jiang L., Dahl R.D., Kitada C., Kubo K., Fujino M., Minamino N., Arimura A.#Isolation of a neuropeptide corresponding to the N-terminal 27 residues of the pituitary adenylate cyclase activating polypeptide with 38 residues (PACAP38).# Biochem. Biophys. Res. Commun. 170:643-648(1990). | |
NP02405 |
HSDGTFTSELSRLRDSARLQRLLQGLV
|
27 | Ovis aries | Glucagon | Secretin | 2034821#Bounjoua Y., Vandermeers A., Robberecht P., Vandermeers-Piret M.C., Christophe J.#Purification and amino acid sequence of vasoactive intestinal peptide, peptide histidine isoleucinamide and secretin from the ovine small intestine.# Regul. Pept. 32:169-179(1991). | |
NP02406 |
HSDAVFTDNYTRLRKQMAVKKYLNSILN
|
28 | Ovis aries | Glucagon | Vasoactive intestinal peptide | 2235680#Gafvelin G.#Isolation and primary structure of VIP from sheep brain.# Peptides 11:703-706(1990).$2034821#Bounjoua Y., Vandermeers A., Robberecht P., Vandermeers-Piret M.C., Christophe J.#Purification and amino acid sequence of vasoactive intestinal peptide, peptide histidine isoleucinamide and secretin from the ovine small intestine.#Regul. Pept. 32:169-179(1991).$1574609#Miyata A., Jiang L., Stibbs H.H., Arimura A.#Chemical characterization of vasoactive intestinal polypeptide-like immunoreactivity in ovine hypothalamus and intestine.#Regul. Pept. 38:145-154(1992). | |
NP02407 |
HADDLLNKAYRNLLGQLSARKYLHTLMAKHLGAVSSSLEDDSEPLS
|
46 | Pelophylax ridibundus | Glucagon | Growth hormone-releasing factor | ||
NP02408 |
HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRIKNK
|
38 | Pelophylax ridibundus | Glucagon | Pituitary adenylate cyclase-activating polypeptide 38 | 1720095#Chartrel N., Tonon M.-C., Vaudry H., Conlon J.M.#Primary structure of frog pituitary adenylate cyclase-activating polypeptide (PACAP) and effects of ovine PACAP on frog pituitary.# Endocrinology 129:3367-3371(1991). | |
NP02409 |
HSDGIFTDSYSRYRKQMAVKKYLAAVL
|
27 | Pelophylax ridibundus | Glucagon | Pituitary adenylate cyclase-activating polypeptide 27 | 1720095#Chartrel N., Tonon M.-C., Vaudry H., Conlon J.M.#Primary structure of frog pituitary adenylate cyclase-activating polypeptide (PACAP) and effects of ovine PACAP on frog pituitary.# Endocrinology 129:3367-3371(1991). | |
NP02410 |
HSDAVFTDNYSRFRKQMAVKKYLNSVLT
|
28 | Pelophylax ridibundus | Glucagon | Vasoactive intestinal peptide | 7540547#Chartrel N., Wang Y., Fournier A., Vaudry H., Conlon J.M.#Frog vasoactive intestinal polypeptide and galanin: primary structures and effects on pituitary adenylate cyclase.# Endocrinology 136:3079-3086(1995). | |
NP02411 |
HSEGTFTSDYSKYLENKQAKDFVRWLMNA
|
29 | Petromyzon marinus | Glucagon | Glucagon-1 | 8405897#Conlon J.M., Nielsen P.F., Youson J.H.#Primary structures of glucagon and glucagon-like peptide isolated from the intestine of the parasitic phase lamprey Petromyzon marinus.# Gen. Comp. Endocrinol. 91:96-104(1993). | |
NP02412 |
HADGTFTNDMTSYLDAKAARDFVSWLARSDKS
|
32 | Petromyzon marinus | Glucagon | Glucagon-like peptide 1-I | 8405897#Conlon J.M., Nielsen P.F., Youson J.H.#Primary structures of glucagon and glucagon-like peptide isolated from the intestine of the parasitic phase lamprey Petromyzon marinus.# Gen. Comp. Endocrinol. 91:96-104(1993). | |
NP02413 |
HAEDVNALLDRTMAKTFIEWLEKQNSNDQTD
|
31 | Petromyzon marinus | Glucagon | Glucagon-like peptide 2-I (By similarity) | ||
NP02414 |
HSQGSFTSDYSKHLDVKQAKDFVTWLLNT
|
29 | Petromyzon marinus | Glucagon | Glucagon-2 | ||
NP02415 |
HSDGSFTNDMNVMLDRMSAKNFLEWLKQQGRG
|
32 | Petromyzon marinus | Glucagon | Glucagon-like peptide 2-II | ||
NP02416 |
HSEGTFSNDYSKYLETQRAQDFVQWLMNS
|
29 | Piaractus mesopotamicus | Glucagon | Glucagon | 10327603#de Lima J.A., Oliveira B., Conlon J.M.#Purification and characterization of insulin and peptides derived from proglucagon and prosomatostatin from the fruit-eating fish, the pacu Piaractus mesopotamicus.# Comp. Biochem. Physiol. 122B:127-135(1999). | |
NP02417 |
HADGTYTSDVSAYLQDQAAKDFITWLKSGQPKQE
|
34 | Piaractus mesopotamicus | Glucagon | Glucagon-like peptide | 10327603#de Lima J.A., Oliveira B., Conlon J.M.#Purification and characterization of insulin and peptides derived from proglucagon and prosomatostatin from the fruit-eating fish, the pacu Piaractus mesopotamicus.# Comp. Biochem. Physiol. 122B:127-135(1999). | |
NP02418 |
YAEGTFISDYSIAMDKIRQQDFVNWLLAQKGKKNDWKHNLTQ
|
42 | Rattus norvegicus | Glucagon | Gastric inhibitory polypeptide | ||
NP02419 |
HSQGTFTSDYSKYLDSRRAQDFVQWLMNT
|
29 | Saimiri sciureus | Glucagon | Glucagon | 2263627#Yu J.-H., Eng J., Yalow R.S.#Isolation and amino acid sequences of squirrel monkey (Saimiri sciurea) insulin and glucagon.# Proc. Natl. Acad. Sci. U.S.A. 87:9766-9768(1990). | |
NP02420 |
HSQGTFTSDYSKYLDTRRAQDFVQWLMST
|
29 | Struthio camelus | Glucagon | Glucagon | 1938110#Ferreira A., Litthauer D., Saayman H., Oelofsen W., Crabb J., Lazure C.#Purification and primary structure of glucagon from ostrich pancreas splenic lobes.# Int. J. Pept. Protein Res. 38:90-95(1991). | |
NP02421 |
YAEGTFISDYSIAMDKIRQQDFVNWLLAQKGKKSDWKHNITQ
|
42 | Sus scrofa | Glucagon | Gastric inhibitory polypeptide | 7227513#Joernvall H., Carlquist M., Kwauk S., Otte S.C., McIntosh C.H.S., Brown J.C., Mutt V.#Amino acid sequence and heterogeneity of gastric inhibitory polypeptide (GIP).# FEBS Lett. 123:205-210(1981).$8375398#Agerberth B., Boman A., Andersson M., Joernvall H., Mutt V., Boman H.G.#Isolation of three antibacterial peptides from pig intestine: gastric inhibitory polypeptide (7-42), diazepam-binding inhibitor (32-86) and a novel factor, peptide 3910.#Eur. J. Biochem. 216:623-629(1993). | |
NP02422 |
RSLQNTEEKSRSFPAPQTDPLDDPDQMTEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA
|
69 | Sus scrofa | Glucagon | Glicentin | 6894800#Thim L., Moody A.J.#The primary structure of porcine glicentin (proglucagon).# Regul. Pept. 2:139-150(1981).$7045833#Thim L., Moody A.J.#The amino acid sequence of porcine glicentin.#Peptides 2 Suppl. 2:37-39(1981). | |
NP02423 |
RSLQNTEEKSRSFPAPQTDPLDDPDQMTED
|
30 | Sus scrofa | Glucagon | Glicentin-related polypeptide (By similarity) | ||
NP02424 |
HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA
|
37 | Sus scrofa | Glucagon | Oxyntomodulin (By similarity) | ||
NP02425 |
HSQGTFTSDYSKYLDSRRAQDFVQWLMNT
|
29 | Sus scrofa | Glucagon | Glucagon | #Bromer W.W., Sinn L.G., Behrens O.K.#The amino acid sequence of glucagon. V. Location of amide groups, acid degradation studies and summary of sequential evidence.#J. Am. Chem. Soc. 79:2807-2810(1957). | |
NP02426 |
HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
|
37 | Sus scrofa | Glucagon | Glucagon-like peptide 1 (By similarity) | ||
NP02427 |
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
|
31 | Sus scrofa | Glucagon | Glucagon-like peptide 1(7-37) | 2753890#Orskov C., Bersani M., Johnsen A.H., Hoejrup P., Holst J.J.#Complete sequences of glucagon-like peptide-1 from human and pig small intestine.#J. Biol. Chem. 264:12826-12829(1989). | |
NP02428 |
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR
|
30 | Sus scrofa | Glucagon | Glucagon-like peptide 1(7-36) | 2753890#Orskov C., Bersani M., Johnsen A.H., Hoejrup P., Holst J.J.#Complete sequences of glucagon-like peptide-1 from human and pig small intestine.#J. Biol. Chem. 264:12826-12829(1989). | |
NP02429 |
HADGSFSDEMNTVLDNLATRDFINWLLHTKITDSL
|
35 | Sus scrofa | Glucagon | Glucagon-like peptide 2 (By similarity) | ||
NP02430 |
DVAHGILNKAYRKVLDQLSARKYLQTLMAKSVGGNLDGGAEDDSEPLS
|
48 | Sus scrofa | Glucagon | PACAP-related peptide | ||
NP02431 |
HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK
|
38 | Sus scrofa | Glucagon | Pituitary adenylate cyclase-activating polypeptide 38 | ||
NP02432 |
HSDGIFTDSYSRYRKQMAVKKYLAAVL
|
27 | Sus scrofa | Glucagon | Pituitary adenylate cyclase-activating polypeptide 27 | #Miyata A., Jiang L., Oka S., Yoshihara T., Arimura A.#Identification of porcine pituitary adenylate cyclase activating polypeptide with 27 residues in the hypothalamic extracts.# Regul. Pept. 37:325-325(1992). | |
NP02433 |
HSDGTFTSELSRLRDSARLQRLLQGLV
|
27 | Sus scrofa | Glucagon | Secretin | 8618828#Bonetto V., Joernvall H., Mutt V., Sillard R.#Two alternative processing pathways for a preprohormone: a bioactive form of secretin.# Proc. Natl. Acad. Sci. U.S.A. 92:11985-11989(1995).$5465996#Mutt V., Jorpes J.E., Magnusson S.#Structure of porcine secretin. The amino acid sequence.#Eur. J. Biochem. 15:513-519(1970).$2395872#Gafvelin G., Joernvall H., Mutt V.#Processing of prosecretin: isolation of a secretin precursor from porcine intestine.#Proc. Natl. Acad. Sci. U.S.A. 87:6781-6785(1990). | |
NP02434 |
YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL
|
44 | Sus scrofa | Glucagon | Somatoliberin | 6418166#Boehlen P., Esch F., Brazeau P., Ling N., Guillemin R.#Isolation and characterization of the porcine hypothalamic growth hormone releasing factor.# Biochem. Biophys. Res. Commun. 116:726-734(1983). | |
NP02435 |
HADGVFTSDFSRLLGQLSAKKYLESLI
|
27 | Sus scrofa | Glucagon | Intestinal peptide PHI-27 | 6947244#Tatemoto K., Mutt V.#Isolation and characterization of the intestinal peptide porcine PHI (PHI-27), a new member of the glucagon-secretin family.# Proc. Natl. Acad. Sci. U.S.A. 78:6603-6607(1981). | |
NP02436 |
HSDAVFTDNYTRLRKQMAVKKYLNSILN
|
28 | Sus scrofa | Glucagon | Vasoactive intestinal peptide | 2843830#Gafvelin G., Andersson M., Dimaline R., Joernvall H., Mutt V.#Isolation and characterization of a variant form of vasoactive intestinal polypeptide.#Peptides 9:469-474(1988).$4829446#Mutt V., Said S.I.#Structure of the porcine vasoactive intestinal octacosapeptide. The amino-acid sequence. Use of kallikrein in its determination.#Eur. J. Biochem. 42:581-589(1974). | |
NP02437 |
HSEGTFTSDYSKYLDNRRAKDFVQWLMNT
|
29 | Torpedo marmorata | Glucagon | Glucagon | 4076759#Conlon J.M., Thim L.#Primary structure of glucagon from an elasmobranchian fish. Torpedo marmorata.# Gen. Comp. Endocrinol. 60:398-405(1985). | |
NP02438 |
HSQGTFTSDYSKYLDTRRAQDFVQWLMST
|
29 | Trachemys scripta | Glucagon | Glucagon | 1974347#Conlon J.M., Hicks J.W.#Isolation and structural characterization of insulin, glucagon and somatostatin from the turtle, Pseudemys scripta.# Peptides 11:461-466(1990). | |
NP02439 |
HSDGIFTDSYSRYRKQMAVQKYLAAVLGRRYRQRVRNK
|
38 | Uranoscopus japonicus | Glucagon | Pituitary adenylate cyclase-activating polypeptide | 9213367#Matsuda K., Takei Y., Katoh J., Shioda S., Arimura A., Uchiyama M.#Isolation and structural characterization of pituitary adenylate cyclase activating polypeptide (PACAP)-like peptide from the brain of a teleost, stargazer, Uranoscopus japonicus.# Peptides 18:723-727(1997). | |
NP02440 |
HSQGTFTSDYSKYLDSRRAQDFVQWLMNT
|
29 | Xenopus laevis | Glucagon | Glucagon | ||
NP02441 |
HAEGTFTSDVTQQLDEKAAKEFIDWLINGGPSKEIIS
|
37 | Xenopus laevis | Glucagon | Glucagon-like peptide 1A | ||
NP02442 |
HAEGTYTNDVTEYLEEKAAKEFIEWLIKGKP
|
31 | Xenopus laevis | Glucagon | Glucagon-like peptide 1B | ||
NP02443 |
HAEGTFTNDMTNYLEEKAAKEFVGWLIKGRP
|
31 | Xenopus laevis | Glucagon | Glucagon-like peptide 1C | ||
NP02444 |
HADGSFTNDINKVLDIIAAQEFLDWVINTQETE
|
33 | Xenopus laevis | Glucagon | Glucagon-like peptide 2 | ||
NP02445 |
HAEGTFTSDVTQHLDEKAAKEFIDWLINGGPTKEIIS
|
37 | Xenopus laevis | Glucagon | Glucagon-like peptide 1A | ||
NP02446 |
HAEGTYTNDVTEYLEEKATKAFIEWLIKGKP
|
31 | Xenopus laevis | Glucagon | Glucagon-like peptide 1B | ||
NP02447 |
HAEGTFTNDMTNYLEEKAAKEFVGWLINGRP
|
31 | Xenopus laevis | Glucagon | Glucagon-like peptide 1C | ||
NP02448 |
YAEGTFISDYSIAMDKIRQQDFVNWLLAQKGKKSDWIHNITQ
|
42 | Bos taurus | Glucagon | Gastric inhibitory polypeptide | 6391923# Carlquist M., Maletti M., Joernvall H., Mutt V.; # "A novel form of gastric inhibitory polypeptide (GIP) isolated from bovine intestine using a radioreceptor assay. Fragmentation with staphylococcal protease results in GIP1-3 and GIP4-42, fragmentation with enterokinase in GIP1-16 and GIP17-42."; # Eur. J. Biochem. 145:573-577(1984). | |
NP02449 |
RSLQNTEEKSSSFPAPQTDPLGDPDQINEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA
|
69 | Bos taurus | Glucagon | Glicentin (By similarity) | ||
NP02450 |
RSLQNTEEKSSSFPAPQTDPLGDPDQINED
|
30 | Bos taurus | Glucagon | Glicentin-related polypeptide (By similarity) | ||
NP02451 |
HSQGTFTSDYSKYLDSRRAQDFVQWLMNT
|
29 | Bos taurus | Glucagon | Glucagon | 5102927# Bromer W.W., Boucher M.E., Koffenberger J.E. Jr.; # "Amino acid sequence of bovine glucagon."; # J. Biol. Chem. 246:2822-2827(1971). | |
NP02452 |
HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
|
37 | Bos taurus | Glucagon | Glucagon-like peptide 1 (By similarity) | ||
NP02453 |
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR
|
30 | Bos taurus | Glucagon | Glucagon-like peptide 1(7-36) (By similarity) | ||
NP02454 |
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
|
31 | Bos taurus | Glucagon | Glucagon-like peptide 1(7-37) (By similarity) | ||
NP02455 |
HADGSFSDEMNTVLDSLATRDFINWLLQTKITD
|
33 | Bos taurus | Glucagon | Glucagon-like peptide 2 (By similarity) | ||
NP02456 |
HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA
|
37 | Bos taurus | Glucagon | Oxyntomodulin (By similarity) | ||
NP02457 |
DVAHGILNKAYRKVLDQPSARRSPADAHGQGLGWDPGGSADDDSEPLS
|
48 | Bos taurus | Glucagon | PACAP-related peptide | ||
NP02458 |
HSDGIFTDSYSRYRKQMAVKKYLAAVL
|
27 | Bos taurus | Glucagon | Pituitary adenylate cyclase-activating polypeptide 27 | ||
NP02459 |
HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK
|
38 | Bos taurus | Glucagon | Pituitary adenylate cyclase-activating polypeptide 38 | ||
NP02460 |
HSDGTFTSELSRLRDSARLQRLLQGLV
|
27 | Bos taurus | Glucagon | Secretin | 7250377# Carlquist M., Joernvall H., Mutt V.; # "Isolation and amino acid sequence of bovine secretin."; # FEBS Lett. 127:71-74(1981). | |
NP02461 |
YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL
|
44 | Bos taurus | Glucagon | Somatoliberin | 6421287# Esch F., Boehlen P., Ling N., Brazeau P., Guillemin R.; # "Isolation and characterization of the bovine hypothalamic growth hormone releasing factor."; # Biochem. Biophys. Res. Commun. 117:772-779(1983). | |
NP02462 |
HADGVFTSDYSRLLGQLSAKKYLESLI
|
27 | Bos taurus | Glucagon | Intestinal peptide PHI-27 | 6548446# Carlquist M., Kaiser R., Tatemoto K., Joernvall H., Mutt V.; # "A novel form of the polypeptide PHI isolated in high yield from bovine upper intestine. Relationships to other peptides of the glucagon-secretin family."; # Eur. J. Biochem. 144:243-247(1984). | |
NP02463 |
HSDAVFTDNYTRLRKQMAVKKYLNSILN
|
28 | Bos taurus | Glucagon | Vasoactive intestinal peptide | 520589#Carlquist M., Mutt V., Joernvall H.; #"Isolation and characterization of bovine vasoactive intestinal peptide (VIP)."; #FEBS Lett. 108:457-460(1979). | |
NP02464 |
YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ
|
42 | Homo sapiens | Glucagon | Gastric inhibitory polypeptide | 6745415# Moody A.J., Thim L., Valverde I.; # "The isolation and sequencing of human gastric inhibitory peptide (GIP)."; # FEBS Lett. 172:142-148(1984). | |
NP02465 |
RSLQDTEEKSRSFSASQADPLSDPDQMNEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA
|
69 | Homo sapiens | Glucagon | Glicentin (By similarity) | ||
NP02466 |
RSLQDTEEKSRSFSASQADPLSDPDQMNED
|
30 | Homo sapiens | Glucagon | Glicentin-related polypeptide (By similarity) | ||
NP02467 |
HSQGTFTSDYSKYLDSRRAQDFVQWLMNT
|
29 | Homo sapiens | Glucagon | Glucagon | 11946536# Thomsen J., Kristiansen K., Brunfeldt K., Sundby F.; # "The amino acid sequence of human glucagon."; # FEBS Lett. 21:315-319(1972). | |
NP02468 |
HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
|
37 | Homo sapiens | Glucagon | Glucagon-like peptide 1 | ||
NP02469 |
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR
|
30 | Homo sapiens | Glucagon | Glucagon-like peptide 1(7-36) | 2753890#Orskov C., Bersani M., Johnsen A.H., Hoejrup P., Holst J.J.; #"Complete sequences of glucagon-like peptide-1 from human and pig small intestine."; #J. Biol. Chem. 264:12826-12829(1989). | |
NP02470 |
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
|
31 | Homo sapiens | Glucagon | Glucagon-like peptide 1(7-37) | ||
NP02471 |
HADGSFSDEMNTILDNLAARDFINWLIQTKITD
|
33 | Homo sapiens | Glucagon | Glucagon-like peptide 2 (By similarity) | ||
NP02472 |
HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA
|
37 | Homo sapiens | Glucagon | Oxyntomodulin (By similarity) | ||
NP02473 |
DVAHGILNEAYRKVLDQLSAGKHLQSLVARGVGGSLGGGAGDDAEPLS
|
48 | Homo sapiens | Glucagon | PACAP-related peptide | ||
NP02474 |
HSDGIFTDSYSRYRKQMAVKKYLAAVL
|
27 | Homo sapiens | Glucagon | Pituitary adenylate cyclase-activating polypeptide 27 | ||
NP02475 |
HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK
|
38 | Homo sapiens | Glucagon | Pituitary adenylate cyclase-activating polypeptide 38 | ||
NP02476 |
HSDGTFTSELSRLREGARLQRLLQGLV
|
27 | Homo sapiens | Glucagon | Secretin | # Carlquist M., Joernvall H., Forssmann W.-G., Thulin L., Johansson C., Mutt V.; # "Human secretin is not identical to the porcine/bovine hormone."; # IRCS Med. Sci. 13:217-218(1985). | |
NP02477 |
YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL
|
44 | Homo sapiens | Glucagon | Somatoliberin | 6812220# Guillemin R., Brazeau P., Boehlen P., Esch F., Ling N., Wehrenberg W.B.; # "Growth hormone-releasing factor from a human pancreatic tumor that caused acromegaly."; # Science 218:585-587(1982). | |
NP02478 |
HADGVFTSDFSKLLGQLSAKKYLESLM
|
27 | Homo sapiens | Glucagon | Intestinal peptide PHM-27 | ||
NP02479 |
HADGVFTSDFSKLLGQLSAKKYLESLMGKRVSSNISEDPVPV
|
42 | Homo sapiens | Glucagon | Intestinal peptide PHV-42 | 3654650# Yiangou Y., di Marzo V., Spokes R.A., Panico M., Morris H.R., Bloom S.R.; # "Isolation, characterization, and pharmacological actions of peptide histidine valine 42, a novel prepro-vasoactive intestinal peptide- derived peptide."; # J. Biol. Chem. 262:14010-14013(1987). | |
NP02480 |
HSDAVFTDNYTRLRKQMAVKKYLNSILN
|
28 | Homo sapiens | Glucagon | Vasoactive intestinal peptide | ||
NP02481 |
HSDAVFTDNYTRLRKQMAVKKYLNSILN
|
28 | Macaca mulatta | Glucagon | Vasoactive intestinal peptide | 2003150# Yu J.-H., Xin Y., Eng J., Yalow R.S.; # "Rhesus monkey gastroenteropancreatic hormones: relationship to human sequences."; # Regul. Pept. 32:39-45(1991). | |
NP02482 |
MSNSRKMSEPPRFFVGPEDAEINPGNYRRFFHHAEEEEEEEDESPPERQIVVGICSMAKKSKSKPMKEILERISLFKYITVVVFEEEIILNEPVENWPLCDCLISFHSKGFPLDKAVAYAKLRNPFVINDLNMQYLIQDRRDVYSILQAEGILLPRYAILNRDPNNPKECNLIEGEDHVEVNGEVFQKPFVEKPVSAEDHNVYIYYPTSAGGGSQRLFRKIGSRSSVYSPESNVRKTGSYIYEEFMPTDGTDVKVYTVGPDYAHAEARKSPALDGKVERDSEGKEVRYPVILNAREKLIAWKVCLAFKQTVCGFDLLRANGQSYVCDVNGFSFVKNSMKYYDDCAKILGNIVMRELAPQFHIPWSIPLEAEDIPIVPTTSGTMMELRCVIAVIRHGDRTPKQKMKMEVRHQKFFDLFEKCDGYKSGKLKLKKPKQLQEVLDIARQLLMELGQNNDSEIEENKSKLEQLKTVLEMYGHFSGINRKVQLTYLPHGCPKTSSEEEDNRREEPSLLLVLKWGGELTPAGRVQAEELGRAFRCMYPGGQGDYAGFPGCGLLRLHSTYRHDLKIYASDEGRVQMTAAAFAKGLLALEGELTPILVQMVKSANMNGLLDSDSDSLSSCQQRVKARLHEILQKDRDFTAEDYEKLTPSGSISVIKSMHLIKNPVKTCDKVYSLIQSLTSQIRYRMEDPKSADIQLYHSETLELMLRRWSKLEKDFKTKNGRYDISKIPDIYDCIKYDVQHNGSLKLENTMELYRLSKALADIVIPQEYGITKAEKLEIAKGYCTPLVRKIRSDLQRTQDDDTVNKLHPVYSRGVLSPERHVRTRLYFTSESHVHSLLSILRYGALCDDSKDEQWKRAMDYLNVVNELNYMTQIVIMLYEDPNKDLSSEERFHVELHFSPGAKGCEEDKNLPSGYGYRPASRENEGRRSLKTDDDEPHTSKRDEVDRAVMLFKPLVSEPIHIHRKSPLPRSRKITANEVVSENANYLRTPRNLVEQKQNPTVGFELYSMVPSICPLETLHNALFLKQVDDFLASIASPSTEVLRKVPEMSSMATRSSPGMRRKISLNTYTPTKILPTPPAALKSSKASSKAAAGGPSQAMAPHTSSRKKSINSKTEGHEPKKSTGKKR
|
1129 | Mus musculus | Glucagon | Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 2 | ||
NP02483 |
YAEGTFISDYSIAMDKIRQQDFVNWLLAQRGKKSDWKHNITQ
|
42 | Mus musculus | Glucagon | Gastric inhibitory polypeptide | ||
NP02484 |
HALQDTEENPRSFPASQTEAHEDPDEMNEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA
|
69 | Mus musculus | Glucagon | Glicentin (By similarity) | ||
NP02485 |
HALQDTEENPRSFPASQTEAHEDPDEMNED
|
30 | Mus musculus | Glucagon | Glicentin-related polypeptide (By similarity) | ||
NP02486 |
HSQGTFTSDYSKYLDSRRAQDFVQWLMNT
|
29 | Mus musculus | Glucagon | Glucagon (By similarity) | ||
NP02487 |
HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
|
37 | Mus musculus | Glucagon | Glucagon-like peptide 1 (By similarity) | ||
NP02488 |
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR
|
30 | Mus musculus | Glucagon | Glucagon-like peptide 1(7-36) (By similarity) | ||
NP02489 |
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
|
31 | Mus musculus | Glucagon | Glucagon-like peptide 1(7-37) (By similarity) | ||
NP02490 |
HADGSFSDEMSTILDNLATRDFINWLIQTKITD
|
33 | Mus musculus | Glucagon | Glucagon-like peptide 2 (By similarity) | ||
NP02491 |
HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA
|
37 | Mus musculus | Glucagon | Oxyntomodulin (By similarity) | ||
NP02492 |
DVAHEILNEAYRKVLDQLSARKYLQSVVARGAGENLGGSAVDDPAPLT
|
48 | Mus musculus | Glucagon | PACAP-related peptide | ||
NP02493 |
HSDGIFTDSYSRYRKQMAVKKYLAAVL
|
27 | Mus musculus | Glucagon | Pituitary adenylate cyclase-activating polypeptide 27 | ||
NP02494 |
HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK
|
38 | Mus musculus | Glucagon | Pituitary adenylate cyclase-activating polypeptide 38 | ||
NP02495 |
HSDGMFTSELSRLQDSARLQRLLQGLV
|
27 | Mus musculus | Glucagon | Secretin (By similarity) | ||
NP02496 |
HVDAIFTTNYRKLLSQLYARKVIQDIMNKQGERIQEQRARLS
|
42 | Mus musculus | Glucagon | Somatoliberin | 1917312#Heimer EP, Ahmad M, Lambros TJ, Felix AM, Downs TR, Frohman LA#Synthesis and biological evaluation of mouse growth hormone-releasing factor#Int J Pept Protein Res 1991 Jun;37(6):552-5 | |
NP02497 |
HADGVFTSDYSRLLGQISAKKYLESLI
|
27 | Mus musculus | Glucagon | Intestinal peptide PHI-27 | ||
NP02498 |
HADGVFTSDYSRLLGQISAKKYLESLIGKRISSSISEDPVPI
|
42 | Mus musculus | Glucagon | Intestinal peptide PHI-42 (By similarity) | ||
NP02499 |
HSDAVFTDNYTRLRKQMAVKKYLNSILN
|
28 | Mus musculus | Glucagon | Vasoactive intestinal peptide | ||
NP02500 |
HAPQDTEENARSFPASQTEPLEDPDQINEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA
|
69 | Rattus norvegicus | Glucagon | Glicentin (By similarity) | ||
NP02501 |
HAPQDTEENARSFPASQTEPLEDPDQINED
|
30 | Rattus norvegicus | Glucagon | Glicentin-related polypeptide (By similarity) | ||
NP02502 |
HSQGTFTSDYSKYLDSRRAQDFVQWLMNT
|
29 | Rattus norvegicus | Glucagon | Glucagon (By similarity) | ||
NP02503 |
HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
|
37 | Rattus norvegicus | Glucagon | Glucagon-like peptide 1 (By similarity) | ||
NP02504 |
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR
|
30 | Rattus norvegicus | Glucagon | Glucagon-like peptide 1(7-36) (By similarity) | ||
NP02505 |
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
|
31 | Rattus norvegicus | Glucagon | Glucagon-like peptide 1(7-37) (By similarity) | ||
NP02506 |
HADGSFSDEMNTILDNLATRDFINWLIQTKITD
|
33 | Rattus norvegicus | Glucagon | Glucagon-like peptide 2 (By similarity) | ||
NP02507 |
HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA
|
37 | Rattus norvegicus | Glucagon | Oxyntomodulin | 7937770# Collie N.L., Walsh J.H., Wong H.C., Shively J.E., Davis M.T., Lee T.D., Reeve J.R. Jr.; # "Purification and sequence of rat oxyntomodulin."; # Proc. Natl. Acad. Sci. U.S.A. 91:9362-9366(1994). | |
NP02508 |
DVAHEILNEAYRKVLDQLSARKYLQSMVARGMGENLAAAAVDDRAPLT
|
48 | Rattus norvegicus | Glucagon | PACAP-related peptide | ||
NP02509 |
HSDGIFTDSYSRYRKQMAVKKYLAAVL
|
27 | Rattus norvegicus | Glucagon | Pituitary adenylate cyclase-activating polypeptide 27 | ||
NP02510 |
HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK
|
38 | Rattus norvegicus | Glucagon | Pituitary adenylate cyclase-activating polypeptide 38 | 2803320# Miyata A., Arimura A., Dahl R.R., Minamino N., Uehara A., Jiang A., Culler M.D., Coy D.H.; # "Isolation of a novel 38 residue-hypothalamic polypeptide which stimulates adenylate cyclase in pituitary cells."; # Biochem. Biophys. Res. Commun. 164:567-574(1989). | |
NP02511 |
HSDGTFTSELSRLQDSARLQRLLQGLV
|
27 | Rattus norvegicus | Glucagon | Secretin | 2719704# Gossen D., Vandermeers A., Vandermeers-Piret M.-C., Rathe J., Cauvin A., Robberecht P., Christophe J.; # "Isolation and primary structure of rat secretin."; # Biochem. Biophys. Res. Commun. 160:862-867(1989). | |
NP02512 |
HADAIFTSSYRRILGQLYARKLLHEIMNRQQGERNQEQRSRFN
|
43 | Rattus norvegicus | Glucagon | Somatoliberin | 6406907# Spiees J., Rivier J., Vale W.; # "Characterization of rat hypothalamic growth hormone-releasing factor."; # Nature 303:532-535(1983).$6440563#Böhlen P, Wehrenberg WB, Esch F, Ling N, Brazeau P, Guillemin R#Rat hypothalamic growth hormone-releasing factor: isolation, sequence analysis and total synthesis#Biochem Biophys Res Commun 1984 Dec 28;125(3):1005-12 | |
NP02513 |
HADGVFTSDYSRLLGQISAKKYLESLI
|
27 | Rattus norvegicus | Glucagon | Intestinal peptide PHI-27 | ||
NP02514 |
HADGVFTSDYSRLLGQISAKKYLESLIGKRISSSISEDPVPV
|
42 | Rattus norvegicus | Glucagon | Intestinal peptide PHV-42 (By similarity) | ||
NP02515 |
HSDAVFTDNYTRLRKQMAVKKYLNSILN
|
28 | Rattus norvegicus | Glucagon | Vasoactive intestinal peptide |