| NPID | NP02301 |
| Name | Glucagon-like peptide 1(7-37) |
| Organism | Canis familiaris |
| NCBI Taxa ID | 9615 |
| Tissue Specificity | Glucagon is secreted in the A cells of the islets of Langerhans. GLP-1, GLP-2, oxyntomodulin and glicentin are secreted from enteroendocrine cells throughout the gastrointestinal tract. GLP-1 and GLP-2 are also secreted in selected neurons in the brain. |
| Family | Glucagon |
| UniProt ID | GLUC_CANFA |
| Length | 31 |
| Modification | |
| Gene Ontology | |
| Sequence | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG |
| Properties | View |
| Structure | |
| Reference |