| NPID | NP02336 | 
| Name | Glicentin-related polypeptide (By similarity) | 
| Organism | Heloderma suspectum | 
| NCBI Taxa ID | 8554 | 
| Tissue Specificity | Isoform LPII is expressed in both pancreas and intestine. Expression of isoform LPI is restricted to the pancreas. Neither isoform is detected in salivary glands. | 
| Family | Glucagon | 
| UniProt ID | GLUC_HELSU | 
| Length | 30 | 
| Modification | |
| Gene Ontology | |
| Sequence | SPLQETEEKSRSFKASQAEPLDDSRQLNEV | 
| Properties | View | 
| Structure | |
| Reference |