| NPID | NP02506 |
| Name | Glucagon-like peptide 2 (By similarity) |
| Organism | Rattus norvegicus |
| NCBI Taxa ID | 10116 |
| Tissue Specificity | Glucagon is secreted in the A cells of the islets of Langerhans. GLP-1, GLP-2, oxyntomodulin and glicentin are secreted from enteroendocrine cells throughout the gastrointestinal tract. |
| Family | Glucagon |
| UniProt ID | GLUC_RAT |
| Length | 33 |
| Modification | |
| Gene Ontology | |
| Sequence | HADGSFSDEMNTILDNLATRDFINWLIQTKITD |
| Properties | View |
| Structure | NA |
| Reference |
Neuropeptide