| NPID | NP02471 |
| Name | Glucagon-like peptide 2 (By similarity) |
| Organism | Homo sapiens |
| NCBI Taxa ID | 9606 |
| Tissue Specificity | Glucagon is secreted in the A cells of the islets of Langerhans. GLP-1, GLP-2, oxyntomodulin and glicentin are secreted from enteroendocrine cells throughout the gastrointestinal tract. GLP-1 and GLP-2 are also secreted in selected neurons in the brain. |
| Family | Glucagon |
| UniProt ID | GLUC_HUMAN |
| Length | 33 |
| Modification | |
| Gene Ontology | |
| Sequence | HADGSFSDEMNTILDNLAARDFINWLIQTKITD |
| Properties | View |
| Structure | |
| Reference |