| NPID | NP02374 |
| Name | Oxyntomodulin (By similarity) |
| Organism | Octodon degus |
| NCBI Taxa ID | 10160 |
| Tissue Specificity | Glucagon is secreted in the A cells of the islets of Langerhans. GLP-1, GLP-2, oxyntomodulin and glicentin are secreted from enteroendocrine cells throughout the gastrointestinal tract. GLP-1 and GLP-2 are also secreted in selected neurons in the brain. |
| Family | Glucagon |
| UniProt ID | GLUC_OCTDE |
| Length | 37 |
| Modification | |
| Gene Ontology | |
| Sequence | HSQGTFTSDYSKFLDTRRAQDFLDWLKNTKRNRNEIA |
| Properties | View |
| Structure | |
| Reference |