| NPID | NP02339 |
| Name | Glucagon-like peptide 1(7-37) (By similarity) |
| Organism | Heloderma suspectum |
| NCBI Taxa ID | 8554 |
| Tissue Specificity | Isoform LPII is expressed in both pancreas and intestine. Expression of isoform LPI is restricted to the pancreas. Neither isoform is detected in salivary glands. |
| Family | Glucagon |
| UniProt ID | GLUC_HELSU |
| Length | 31 |
| Modification | |
| Gene Ontology | |
| Sequence | HADGRYTSDISSYLEGQAAKEFIAWLVNGRG |
| Properties | View |
| Structure | |
| Reference |