| NPID | NP02296 | 
| Name | Glicentin | 
| Organism | Canis familiaris | 
| NCBI Taxa ID | 9615 | 
| Tissue Specificity | Glucagon is secreted in the A cells of the islets of Langerhans. GLP-1, GLP-2, oxyntomodulin and glicentin are secreted from enteroendocrine cells throughout the gastrointestinal tract. GLP-1 and GLP-2 are also secreted in selected neurons in the brain. | 
| Family | Glucagon | 
| UniProt ID | GLUC_CANFA | 
| Length | 69 | 
| Modification | |
| Gene Ontology | |
| Sequence | RSLQDTEEKSRSFSAPQTEPLNDLDQMNEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA | 
| Properties | View | 
| Structure | |
| Reference | 
