NPID | NP02427 |
Name | Glucagon-like peptide 1(7-37) |
Organism | Sus scrofa |
NCBI Taxa ID | 9823 |
Tissue Specificity | Glucagon is secreted in the A cells of the islets of Langerhans. GLP-1, GLP-2, oxyntomodulin and glicentin are secreted from enteroendocrine cells throughout the gastrointestinal tract. GLP-1 and GLP-2 are also secreted in selected neurons in the brain. |
Family | Glucagon |
UniProt ID | GLUC_PIG |
Length | 31 |
Modification | |
Gene Ontology | |
Sequence | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG |
Properties | View |
Structure | |
Reference |