Total number of results for Pyrokinin are 266
Download
as Fasta All
| NPID | Sequence | Length | Organism | Family | Name | PMID | Peptide_REF |
|---|---|---|---|---|---|---|---|
| NP04948 | AGGTGANSAMWFGPRL |
16 | Anopheles gambiae | Pyrokinin | Pyrokinin-1 | 17709098#Olsen SS, Cazzamali G, Williamson M, Grimmelikhuijzen CJ, Hauser F#Identification of one capa and two pyrokinin receptors from the malaria mosquito Anopheles gambiae#Biochem Biophys Res Commun 2007 Oct 19;362(2):245-51 | |
| NP04949 | TVKLTPRL |
8 | Lepidoptera | Pyrokinin | PBAN-encoding gene neuropeptides 8 | 15350612#Choi MY, Lee JM, Han KS, Boo KS#Identification of a new member of PBAN family and immunoreactivity in the central nervous system from Adoxophyes sp#(Lepidoptera: Tortricidae) Insect Biochem Mol Biol 2004 Sep;34(9):927-35 | |
| NP04950 | GFKNVALSTARGF |
13 | Leptinotarsa decemlineata | Pyrokinin | myotropin | 8580496#Spittaels K, Vankeerberghen A, Schoofs L, Proost P, Van Damme J, De Loof A#Isolation and characterization of Locusta migratoria accessory gland myotropin I (Lom-Ag-MT-I) from the brain of the Colorado potato beetle, Leptinotarsa decemlineata#Arch Insect Biochem Physiol 1996;31(2):149-55 | |
| NP04951 | EDSGDGWPQQPFVPRL |
16 | Locusta migratoria | Pyrokinin | locustapyrokinin | 2026322#Schoofs L, Holman GM, Hayes TK, Nachman RJ, De Loof A#Isolation, primary structure, and synthesis of locustapyrokinin: a myotropic peptide of Locusta migratoria#Gen Comp Endocrinol 1991 Jan;81(1):97-104 | |
| NP04952 | ESVPTFTPRL |
10 | Locusta migratoria | Pyrokinin | locustapyrokinin II | 7903606#Schoofs L, Holman GM, Nachman R, Proost P, Van Damme J, De Loof A#Isolation, identification and synthesis of locustapyrokinin II from Locusta migratoria, another member of the FXPRL-amide peptide family#Comp Biochem Physiol C 1993 Sep;106(1):103-9 | |
| NP04953 | KLSYDDKVFENVEFTPRL |
18 | Mythimna separata | Pyrokinin | Pseudaletia pheromonotropin | 1734867#Matsumoto S, Fónagy A, Kurihara M, Uchiumi K, Nagamine T, Chijimatsu M, Mitsui T#Isolation and primary structure of a novel pheromonotropic neuropeptide structurally related to leucopyrokinin from the armyworm larvae, Pseudaletia separata#Biochem Biophys Res Commun 1992 Jan 31;182(2):534-9 | |
| NP04954 | TSFTPRL |
7 | NA | Pyrokinin | Leucopyrokinin | 9437758#Plech A, Rykaczewska-Czerwińska M, Bartosz-Bechowski H, Lombarska-Sliwińska D, Małota M, Szewczyk M, Brus R, Konopińska D#Insect neuropeptide leucopyrokinin analogues--synthesis and antinociceptive effect in rats#Pol J Pharmacol 1997 Mar-Jun;49(2-3):119-26 | |
| NP04955 | QTSFTPRL |
8 | Sarcophaga bullata | Pyrokinin | Leucopyrokinin | 12770042#Zd'árek J, Myska P, Zemek R, Nachman RJ#Mode of action of an insect neuropeptide leucopyrokinin (LPK) on pupariation in fleshfly (Sarcophaga bullata) larvae (Diptera: Sarcophagidae)#J Insect Physiol 2002 Oct;48(10):951-959 | |
| NP04956 | GSGEDLSYGDAYEVDEDDHPLFVPRL |
26 | Solenopsis invicta | Pyrokinin | Pheromone biosynthesis activating neuropeptide | 19320757#Choi MY, Vander Meer RK#Identification of a new member of the PBAN family of neuropeptides from the fire ant, Solenopsis invicta#Insect Mol Biol 2009 Apr;18(2):161-9 | |
| NP04957 | HVVNFTPRL |
9 | Tenebrio molitor | Pyrokinin | Pyrokinin-1 | 18201799#Weaver RJ, Audsley N#Neuropeptides of the beetle, Tenebrio molitor identified using MALDI-TOF mass spectrometry and deduced sequences from the Tribolium castaneum genome#Peptides 2008 Feb;29(2):168-78 | |
| NP04958 | AGNSGANSGMWFGPRL |
16 | Aedes aegypti | Pyrokinin | CAPA-Pyrokinin | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
| NP04959 | RVPWTPSPRL |
10 | Apis mellifera | Pyrokinin | Pheromone biosynthesis activating neuropeptide | 19576913#Boerjan B, Cardoen D, Bogaerts A, Landuyt B, Schoofs L, Verleyen P#Mass spectrometric profiling of (neuro)-peptides in the worker honeybee, Apis mellifera#Neuropharmacology 2010 Jan;58(1):248-58 | |
| NP04960 | TNFAFSPRL |
9 | Callinectes sapidus | Pyrokinin | Pyrokinin | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
| NP04961 | TNFAFSPRL |
9 | Cancer borealis | Pyrokinin | Pyrokinin-1 | 18700782#Behrens HL, Chen R, Li L#Combining microdialysis, NanoLC-MS, and MALDI-TOF/TOF to detect neuropeptides secreted in the crab, Cancer borealis#Anal Chem 2008 Sep 15;80(18):6949-58 | |
| NP04962 | DTGFAFSPRL |
10 | Carcinus maenas | Pyrokinin | Pyrokinin | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP04963 | LYFAPRL |
7 | Carcinus maenas | Pyrokinin | Pyrokinin | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP04964 | TSFAFSPRL |
9 | Carcinus maenas | Pyrokinin | Pyrokinin | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP04965 | GPSASSGLWFGPRL |
14 | Drosophila melanogaster | Pyrokinin | Drm-PK-1 2-15 | 16441518#Wegener C, Reinl T, Jänsch L, Predel R#Direct mass spectrometric peptide profiling and fragmentation of larval peptide hormone release sites in Drosophila melanogaster reveals tagma-specific peptide expression and differential processing#J Neurochem 2006 Mar;96(5):1362-74 | |
| NP04966 | LYTHFSTRL |
9 | Euschistus servus | Pyrokinin | Pyrokinin-1 | 18201800#Predel R, Russell WK, Russell DH, Lopez J, Esquivel J, Nachman RJ#Comparative peptidomics of four related hemipteran species: pyrokinins, myosuppressin, corazonin, adipokinetic hormone, sNPF, and periviscerokinins#Peptides 2008 Feb;29(2):162-7 | |
| NP04967 | QLAFRPML |
8 | Euschistus servus | Pyrokinin | Pyrokinin-2 | 18201800#Predel R, Russell WK, Russell DH, Lopez J, Esquivel J, Nachman RJ#Comparative peptidomics of four related hemipteran species: pyrokinins, myosuppressin, corazonin, adipokinetic hormone, sNPF, and periviscerokinins#Peptides 2008 Feb;29(2):162-7 | |
| NP04968 | VIFTPKL |
7 | Galleria mellonella | Pyrokinin | Alpha-SG neuropeptide | 15706623#Huybrechts J, Verleyen P, Schoofs L#Mass spectrometric analysis of head ganglia and neuroendocrine tissue of larval Galleria mellonella (Arthropoda, Insecta)#J Mass Spectrom 2005 Feb;40(2):271-6 | |
| NP04969 | FSPRL |
5 | Homarus americanus | Pyrokinin | Pyrokinin | 18304551#Ma M, Chen R, Sousa GL, Bors EK, Kwiatkowski MA, Goiney CC, Goy MF, Christie AE, Li L#Mass spectral characterization of peptide transmitters/hormones in the nervous system and neuroendocrine organs of the American lobster Homarus americanus#Gen Comp Endocrinol 2008 Apr 1;156(2):395-409 | |
| NP04970 | RSNNFTPRI |
9 | Ixodes scapularis | Pyrokinin | Pyrokinin-1 | 19540946#Neupert S, Russell WK, Predel R, Russell DH, Strey OF, Teel PD, Nachman RJ#The neuropeptidomics of Ixodes scapularis synganglion#J Proteomics 2009 Aug 20;72(6):1040-5 | |
| NP04971 | GSFVPRL |
7 | Ixodes scapularis | Pyrokinin | Pyrokinin-2 | 19540946#Neupert S, Russell WK, Predel R, Russell DH, Strey OF, Teel PD, Nachman RJ#The neuropeptidomics of Ixodes scapularis synganglion#J Proteomics 2009 Aug 20;72(6):1040-5 | |
| NP04972 | GSFTPRI |
7 | Ixodes scapularis | Pyrokinin | Pyrokinin-3 | 19540946#Neupert S, Russell WK, Predel R, Russell DH, Strey OF, Teel PD, Nachman RJ#The neuropeptidomics of Ixodes scapularis synganglion#J Proteomics 2009 Aug 20;72(6):1040-5 | |
| NP04973 | TPFTPRL |
7 | Ixodes scapularis | Pyrokinin | Pyrokinin-4 | 19540946#Neupert S, Russell WK, Predel R, Russell DH, Strey OF, Teel PD, Nachman RJ#The neuropeptidomics of Ixodes scapularis synganglion#J Proteomics 2009 Aug 20;72(6):1040-5 | |
| NP04974 | ADFAFNPRL |
9 | Litopenaeus vannamei | Pyrokinin | pyrokinin | 19852991#Ma M, Gard AL, Xiang F, Wang J, Davoodian N, Lenz PH, Malecha SR, Christie AE, Li L#Combining in silico transcriptome mining and biological mass spectrometry for neuropeptide discovery in the Pacific white shrimp Litopenaeus vannamei#Peptides 2010 Jan;31(1):27-43 | |
| NP04975 | ADFAFSPRL |
9 | Litopenaeus vannamei | Pyrokinin | pyrokinin | 19852991#Ma M, Gard AL, Xiang F, Wang J, Davoodian N, Lenz PH, Malecha SR, Christie AE, Li L#Combining in silico transcriptome mining and biological mass spectrometry for neuropeptide discovery in the Pacific white shrimp Litopenaeus vannamei#Peptides 2010 Jan;31(1):27-43 | |
| NP04976 | DFAFNPRL |
8 | Litopenaeus vannamei | Pyrokinin | pyrokinin | 19852991#Ma M, Gard AL, Xiang F, Wang J, Davoodian N, Lenz PH, Malecha SR, Christie AE, Li L#Combining in silico transcriptome mining and biological mass spectrometry for neuropeptide discovery in the Pacific white shrimp Litopenaeus vannamei#Peptides 2010 Jan;31(1):27-43 | |
| NP04977 | DFAFSPRL |
8 | Litopenaeus vannamei | Pyrokinin | pyrokinin | 19852991#Ma M, Gard AL, Xiang F, Wang J, Davoodian N, Lenz PH, Malecha SR, Christie AE, Li L#Combining in silico transcriptome mining and biological mass spectrometry for neuropeptide discovery in the Pacific white shrimp Litopenaeus vannamei#Peptides 2010 Jan;31(1):27-43 | |
| NP04978 | DFSFNPRL |
8 | Litopenaeus vannamei | Pyrokinin | pyrokinin | 19852991#Ma M, Gard AL, Xiang F, Wang J, Davoodian N, Lenz PH, Malecha SR, Christie AE, Li L#Combining in silico transcriptome mining and biological mass spectrometry for neuropeptide discovery in the Pacific white shrimp Litopenaeus vannamei#Peptides 2010 Jan;31(1):27-43 | |
| NP04979 | GDFAFNPRL |
9 | Litopenaeus vannamei | Pyrokinin | pyrokinin | 19852991#Ma M, Gard AL, Xiang F, Wang J, Davoodian N, Lenz PH, Malecha SR, Christie AE, Li L#Combining in silico transcriptome mining and biological mass spectrometry for neuropeptide discovery in the Pacific white shrimp Litopenaeus vannamei#Peptides 2010 Jan;31(1):27-43 | |
| NP04980 | GDFAFSPRL |
9 | Litopenaeus vannamei | Pyrokinin | pyrokinin | 19852991#Ma M, Gard AL, Xiang F, Wang J, Davoodian N, Lenz PH, Malecha SR, Christie AE, Li L#Combining in silico transcriptome mining and biological mass spectrometry for neuropeptide discovery in the Pacific white shrimp Litopenaeus vannamei#Peptides 2010 Jan;31(1):27-43 | |
| NP04981 | SGGFAFSPRL |
10 | Litopenaeus vannamei | Pyrokinin | Pyrokinin | 19852991#Ma M, Gard AL, Xiang F, Wang J, Davoodian N, Lenz PH, Malecha SR, Christie AE, Li L#Combining in silico transcriptome mining and biological mass spectrometry for neuropeptide discovery in the Pacific white shrimp Litopenaeus vannamei#Peptides 2010 Jan;31(1):27-43 | |
| NP04982 | YSFLPRL |
7 | Litopenaeus vannamei | Pyrokinin | pyrokinin | 19852991#Ma M, Gard AL, Xiang F, Wang J, Davoodian N, Lenz PH, Malecha SR, Christie AE, Li L#Combining in silico transcriptome mining and biological mass spectrometry for neuropeptide discovery in the Pacific white shrimp Litopenaeus vannamei#Peptides 2010 Jan;31(1):27-43 | |
| NP04983 | GAVPAAQWFSPRL |
13 | Locusta migratoria | Pyrokinin | Locustamyotropin-1 | 11121115#Torfs P, Nieto J, Cerstiaens A, Boon D, Baggerman G, Poulos C, Waelkens E, Derua R, Calderón J, De Loof A, Schoofs L#Pyrokinin neuropeptides in a crustacean#Isolation and identification in the white shrimp Penaeus vannamei Eur J Biochem 2001 Jan;268(1):149-54 | |
| NP04984 | QDSGDEWPQQPFVPRL |
16 | Locusta migratoria | Pyrokinin | Locustapyrokinin-1 | 11121115#Torfs P, Nieto J, Cerstiaens A, Boon D, Baggerman G, Poulos C, Waelkens E, Derua R, Calderón J, De Loof A, Schoofs L#Pyrokinin neuropeptides in a crustacean#Isolation and identification in the white shrimp Penaeus vannamei Eur J Biochem 2001 Jan;268(1):149-54 | |
| NP04985 | GPSATTGVWFGPRL |
14 | Lucilia cuprina | Pyrokinin | CAPA-Pyrokinin | 23280433#Rahman MM, Neupert S, Predel R#Neuropeptidomics of the Australian sheep blowfly Lucilia cuprina (Wiedemann) and related Diptera#Peptides 2013 Mar;41:31-7 | |
| NP04986 | TGPSATTGVWFGPRL |
15 | Lucilia cuprina | Pyrokinin | CAPA-Pyrokinin | 23280433#Rahman MM, Neupert S, Predel R#Neuropeptidomics of the Australian sheep blowfly Lucilia cuprina (Wiedemann) and related Diptera#Peptides 2013 Mar;41:31-7 | |
| NP04987 | SVQFKPRL |
8 | Lucilia cuprina | Pyrokinin | Pyrokinin | 23280433#Rahman MM, Neupert S, Predel R#Neuropeptidomics of the Australian sheep blowfly Lucilia cuprina (Wiedemann) and related Diptera#Peptides 2013 Mar;41:31-7 | |
| NP04988 | TEGPGMWFGPRL |
12 | Manduca sexta | Pyrokinin | Pyrokinin | 19350635#Herbert Z, Pollák E, Zougman A, Boros A, Kapan N, Molnár L#Identification of novel neuropeptides in the ventral nerve cord ganglia and their targets in an annelid worm, Eisenia fetida#J Comp Neurol 2009 Jun 10;514(5):415-32 | |
| NP04989 | QYDGRGSDMVEGPRVERMHPETSGGCVGAHCLTQNSEGPVGAMWFGPRL |
49 | Nasonia vitripennis | Pyrokinin | Pyrokinin-1 | 20695486#Hauser F, Neupert S, Williamson M, Predel R, Tanaka Y, Grimmelikhuijzen CJ#Genomics and peptidomics of neuropeptides and protein hormones present in the parasitic wasp Nasonia vitripennis#J Proteome Res 2010 Oct 1;9(10):5296-310 | |
| NP04990 | QETTFTPRL |
9 | Nasonia vitripennis | Pyrokinin | Pyrokinin-2 | 20695486#Hauser F, Neupert S, Williamson M, Predel R, Tanaka Y, Grimmelikhuijzen CJ#Genomics and peptidomics of neuropeptides and protein hormones present in the parasitic wasp Nasonia vitripennis#J Proteome Res 2010 Oct 1;9(10):5296-310 | |
| NP04991 | DQQAPPPMFPPRL |
13 | Nasonia vitripennis | Pyrokinin | Pyrokinin-3 | 20695486#Hauser F, Neupert S, Williamson M, Predel R, Tanaka Y, Grimmelikhuijzen CJ#Genomics and peptidomics of neuropeptides and protein hormones present in the parasitic wasp Nasonia vitripennis#J Proteome Res 2010 Oct 1;9(10):5296-310 | |
| NP04992 | NGSAGNGGLWFGPRL |
15 | Nezara viridula | Pyrokinin | CAPA-Pyrokinin | 18201800#Predel R, Russell WK, Russell DH, Lopez J, Esquivel J, Nachman RJ#Comparative peptidomics of four related hemipteran species: pyrokinins, myosuppressin, corazonin, adipokinetic hormone, sNPF, and periviscerokinins#Peptides 2008 Feb;29(2):162-7 | |
| NP04993 | FYAPFSPRL |
9 | Nezara viridula | Pyrokinin | Pyrokinin-1 | 18201800#Predel R, Russell WK, Russell DH, Lopez J, Esquivel J, Nachman RJ#Comparative peptidomics of four related hemipteran species: pyrokinins, myosuppressin, corazonin, adipokinetic hormone, sNPF, and periviscerokinins#Peptides 2008 Feb;29(2):162-7 | |
| NP04994 | QLVSFRPRL |
9 | Nezara viridula | Pyrokinin | Pyrokinin-2 | 18201800#Predel R, Russell WK, Russell DH, Lopez J, Esquivel J, Nachman RJ#Comparative peptidomics of four related hemipteran species: pyrokinins, myosuppressin, corazonin, adipokinetic hormone, sNPF, and periviscerokinins#Peptides 2008 Feb;29(2):162-7 | |
| NP04995 | SPPFAPRL |
8 | Nezara viridula | Pyrokinin | Pyrokinin-2 | 18201800#Predel R, Russell WK, Russell DH, Lopez J, Esquivel J, Nachman RJ#Comparative peptidomics of four related hemipteran species: pyrokinins, myosuppressin, corazonin, adipokinetic hormone, sNPF, and periviscerokinins#Peptides 2008 Feb;29(2):162-7 | |
| NP04996 | LYFAPRL |
7 | Ocypode ceratophthalma | Pyrokinin | Pyrokinin | 23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34 | |
| NP04997 | TDGFAFSPRL |
10 | Ocypode ceratophthalma | Pyrokinin | Pyrokinin | 23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34 | |
| NP04998 | DHLPHVYSPRL |
11 | Periplaneta americana | Pyrokinin | Pyrokinin-4 | 11121115#Torfs P, Nieto J, Cerstiaens A, Boon D, Baggerman G, Poulos C, Waelkens E, Derua R, Calderón J, De Loof A, Schoofs L#Pyrokinin neuropeptides in a crustacean#Isolation and identification in the white shrimp Penaeus vannamei Eur J Biochem 2001 Jan;268(1):149-54 | |
| NP04999 | XXXFXPRL |
8 | Sarcophaga bullata | Pyrokinin | Pyrokinin-2 | 15033466#Verleyen P, Huybrechts J, Sas F, Clynen E, Baggerman G, De Loof A, Schoofs L#Neuropeptidomics of the grey flesh fly, Neobellieria bullata#Biochem Biophys Res Commun 2004 Apr 9;316(3):763-70 | |
| NP05000 | GAAPAAQFSPRL |
12 | Schistocerca gregaria | Pyrokinin | Schistomyotropin-1 | 11121115#Torfs P, Nieto J, Cerstiaens A, Boon D, Baggerman G, Poulos C, Waelkens E, Derua R, Calderón J, De Loof A, Schoofs L#Pyrokinin neuropeptides in a crustacean#Isolation and identification in the white shrimp Penaeus vannamei Eur J Biochem 2001 Jan;268(1):149-54 | |
| NP05001 | LPHYPRL |
7 | Zophobas atratus | Pyrokinin | Pyrokinin-1 | 21067424#Marciniak P, Audsley N, Kuczer M, Rosinski G#Identification of myotropic neuropeptides from the brain and corpus cardiacum-corpus allatum complex of the beetle, Zophobas atratus#J Insect Sci 2010;10:156 | |
| NP05002 | SPPFAPRL |
8 | Zophobas atratus | Pyrokinin | Pyrokinin-2 | 21067424#Marciniak P, Audsley N, Kuczer M, Rosinski G#Identification of myotropic neuropeptides from the brain and corpus cardiacum-corpus allatum complex of the beetle, Zophobas atratus#J Insect Sci 2010;10:156 | |
| NP05003 | AAAMWFGPRL |
10 | Aedes aegypti | Pyrokinin | AAAMWFGPRL-amide (By similarity) | ||
| NP05004 | DASSSNENNSRPPFAPRL |
18 | Aedes aegypti | Pyrokinin | DASSSNENNSRPPFAPRL-amide (By similarity) | ||
| NP05005 | NLPFSPRL |
8 | Aedes aegypti | Pyrokinin | NLPFSPRL-amide (By similarity) | ||
| NP05006 | QPQPVFYHSTTPRL |
14 | Aedes aegypti | Pyrokinin | QPQPVFYHSTTPRL-amide (By similarity) | ||
| NP05007 | VIFTPKL |
7 | Agrotis ipsilon | Pyrokinin | Alpha-SG neuropeptide (Potential) | ||
| NP05008 | SLSYEDKMFDNVEFTPRL |
18 | Agrotis ipsilon | Pyrokinin | Beta-SG neuropeptide (Potential) | ||
| NP05009 | DVKDGGADRGAHSDRGGMWFGPRI |
24 | Agrotis ipsilon | Pyrokinin | Diapause hormone homolog (Potential) | ||
| NP05010 | TMNFSPRL |
8 | Agrotis ipsilon | Pyrokinin | Gamma-SG neuropeptide (Potential) | ||
| NP05011 | LADDTPATPADQEMYRPDPEQIDSRTKYFSPRL |
33 | Agrotis ipsilon | Pyrokinin | Pheromone biosynthesis-activating neuropeptide | ||
| NP05012 | AAAMWFGPRL |
10 | Anopheles gambiae | Pyrokinin | AAAMWFGPRL-amide (By similarity) | ||
| NP05013 | DSVGENHQRPPFAPRL |
16 | Anopheles gambiae | Pyrokinin | DSVGENHQRPPFAPRL-amide (By similarity) | ||
| NP05014 | NLPFSPRL |
8 | Anopheles gambiae | Pyrokinin | NLPFSPRL-amide (By similarity) | ||
| NP05015 | PQPIFYHTTSPRL |
13 | Anopheles gambiae | Pyrokinin | PQPIFYHTTSPRL-amide (By similarity) | ||
| NP05016 | IYLPLFASRL |
10 | Apis mellifera | Pyrokinin | IYLPLFASRL-amide | 17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J., Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L., Robinson G.E., Sweedler J.V.; #From the genome to the proteome: uncovering peptides in the Apis brain.; #Science 314:647-649(2006). | |
| NP05017 | QITQFTPRL |
9 | Apis mellifera | Pyrokinin | QITQFTPRL-amide | 17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J., Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L., Robinson G.E., Sweedler J.V.; #From the genome to the proteome: uncovering peptides in the Apis brain.; #Science 314:647-649(2006). | |
| NP05018 | TSQDITSGMWFGPRL |
15 | Apis mellifera | Pyrokinin | TSQDITSGMWFGPRL-amide | 17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J., Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L., Robinson G.E., Sweedler J.V.; #From the genome to the proteome: uncovering peptides in the Apis brain.; #Science 314:647-649(2006). | |
| NP05019 | VPWTPSPRL |
9 | Apis mellifera | Pyrokinin | VPWTPSPRL-amide | 17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J., Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L., Robinson G.E., Sweedler J.V.; #From the genome to the proteome: uncovering peptides in the Apis brain.; #Science 314:647-649(2006). | |
| NP05020 | SGDTSSQAKGMWFGPRL |
17 | Aptera fusca | Pyrokinin | Pyrokinin-5 | 19257902#Roth S., Fromm B., Gaede G., Predel R.; #A proteomic approach for studying insect phylogeny: CAPA peptides of ancient insect taxa (Dictyoptera, Blattoptera) as a test case.; #BMC Evol. Biol. 9:50-50(2009).$ #Predel R.; # #Submitted (SEP-2005) to UniProtKB. | |
| NP05021 | EGANSNEAKGMWFGPRL |
17 | Archimandrita tessellata | Pyrokinin | Pyrokinin-5 | 19257902#Roth S., Fromm B., Gaede G., Predel R.; #A proteomic approach for studying insect phylogeny: CAPA peptides of ancient insect taxa (Dictyoptera, Blattoptera) as a test case.; #BMC Evol. Biol. 9:50-50(2009).$ #Predel R.; # #Submitted (MAY-2005) to UniProtKB. | |
| NP05022 | DGYTPRL |
7 | Austrophasma gansbaaiense | Pyrokinin | Pyrokinin-1 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
| NP05023 | SPPFAPRL |
8 | Austrophasma gansbaaiense | Pyrokinin | Pyrokinin-2 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
| NP05024 | DPPFSPRL |
8 | Austrophasma gansbaaiense | Pyrokinin | Pyrokinin-3 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
| NP05025 | SSGGGEGSGMWFGPRL |
16 | Austrophasma gansbaaiense | Pyrokinin | CAPA-Pyrokinin | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
| NP05026 | DGYTPRL |
7 | Austrophasma rawsonvillense | Pyrokinin | Pyrokinin-1 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
| NP05027 | SPPFAPRL |
8 | Austrophasma rawsonvillense | Pyrokinin | Pyrokinin-2 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
| NP05028 | DPPFSPRL |
8 | Austrophasma rawsonvillense | Pyrokinin | Pyrokinin-3 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
| NP05029 | SGGGEGSGMWFGPRL |
15 | Austrophasma rawsonvillense | Pyrokinin | CAPA-Pyrokinin | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
| NP05030 | SGETSGEGNGMWFGPRL |
17 | Bantua robusta | Pyrokinin | Pyrokinin-5 | 19257902#Roth S., Fromm B., Gaede G., Predel R.; #A proteomic approach for studying insect phylogeny: CAPA peptides of ancient insect taxa (Dictyoptera, Blattoptera) as a test case.; #BMC Evol. Biol. 9:50-50(2009). | |
| NP05031 | AGESSNEAKGMWFGPRL |
17 | Blaberus craniifer | Pyrokinin | Pyrokinin-5 | 19257902#Roth S., Fromm B., Gaede G., Predel R.; #A proteomic approach for studying insect phylogeny: CAPA peptides of ancient insect taxa (Dictyoptera, Blattoptera) as a test case.; #BMC Evol. Biol. 9:50-50(2009). | |
| NP05032 | AGESSNEAKGMWFGPRL |
17 | Blaberus giganteus | Pyrokinin | Pyrokinin-5 | 19257902#Roth S., Fromm B., Gaede G., Predel R.; #A proteomic approach for studying insect phylogeny: CAPA peptides of ancient insect taxa (Dictyoptera, Blattoptera) as a test case.; #BMC Evol. Biol. 9:50-50(2009). | |
| NP05033 | AGESSNEAKGMWFGPRL |
17 | Blaptica dubia | Pyrokinin | Pyrokinin-5a | #Predel R.; ##Submitted (MAY-2005) to UniProtKB. | |
| NP05034 | GGESSNEAKGMWFGPRL |
17 | Blaptica dubia | Pyrokinin | Pyrokinin-5b | 19257902#Roth S., Fromm B., Gaede G., Predel R.; #A proteomic approach for studying insect phylogeny: CAPA peptides of ancient insect taxa (Dictyoptera, Blattoptera) as a test case.; #BMC Evol. Biol. 9:50-50(2009). | |
| NP05035 | DHLPHDVYSPRL |
12 | Blatta lateralis | Pyrokinin | Pyrokinin-4 | 15626499#Predel R., Gaede G.; #Peptidomics of neurohemal organs from species of the cockroach family Blattidae: how do neuropeptides of closely related species differ?; #Peptides 26:3-9(2005). | |
| NP05036 | GGGGSGETSGMWFGPRL |
17 | Blatta lateralis | Pyrokinin | Pyrokinin-5 | 19257902#Roth S., Fromm B., Gaede G., Predel R.; #A proteomic approach for studying insect phylogeny: CAPA peptides of ancient insect taxa (Dictyoptera, Blattoptera) as a test case.; #BMC Evol. Biol. 9:50-50(2009). | |
| NP05037 | SESEVPGMWFGPRL |
14 | Blatta lateralis | Pyrokinin | Pyrokinin-6 | 15626499#Predel R., Gaede G.; #Peptidomics of neurohemal organs from species of the cockroach family Blattidae: how do neuropeptides of closely related species differ?; #Peptides 26:3-9(2005). | |
| NP05038 | DHLPHDVYSPRL |
12 | Blatta orientalis | Pyrokinin | Pyrokinin-4 | 15626499#Predel R., Gaede G.; #Peptidomics of neurohemal organs from species of the cockroach family Blattidae: how do neuropeptides of closely related species differ?; #Peptides 26:3-9(2005). | |
| NP05039 | GGGGSGETSGMWFGPRL |
17 | Blatta orientalis | Pyrokinin | Pyrokinin-5 | 19257902#Roth S., Fromm B., Gaede G., Predel R.; #A proteomic approach for studying insect phylogeny: CAPA peptides of ancient insect taxa (Dictyoptera, Blattoptera) as a test case.; #BMC Evol. Biol. 9:50-50(2009). | |
| NP05040 | SESEVPGMWFGPRL |
14 | Blatta orientalis | Pyrokinin | Pyrokinin-6 | 15626499#Predel R., Gaede G.; #Peptidomics of neurohemal organs from species of the cockroach family Blattidae: how do neuropeptides of closely related species differ?; #Peptides 26:3-9(2005). | |
| NP05041 | ESGGSGEANGMWFGPRL |
17 | Blattella germanica | Pyrokinin | Pyrokinin-5 | 19257902#Roth S., Fromm B., Gaede G., Predel R.; #A proteomic approach for studying insect phylogeny: CAPA peptides of ancient insect taxa (Dictyoptera, Blattoptera) as a test case.; #BMC Evol. Biol. 9:50-50(2009). | |
| NP05042 | SGETSGEGNGMWFGPRL |
17 | Blepharodera discoidalis | Pyrokinin | Pyrokinin-5 | 19257902#Roth S., Fromm B., Gaede G., Predel R.; #A proteomic approach for studying insect phylogeny: CAPA peptides of ancient insect taxa (Dictyoptera, Blattoptera) as a test case.; #BMC Evol. Biol. 9:50-50(2009). | |
| NP05043 | IIFTPKL |
7 | Bombyx mori | Pyrokinin | Alpha-SG neuropeptide | 8475067#Sato Y., Oguchi M., Menjo N., Imai K., Saito H., Ikeda M., Isobe M., Yamashita O.; #Precursor polyprotein for multiple neuropeptides secreted from the suboesophageal ganglion of the silkworm Bombyx mori: characterization of the cDNA encoding the diapause hormone precursor and identification of additional peptides.; #Proc. Natl. Acad. Sci. U.S.A. 90:3251-3255(1993). | |
| NP05044 | SVAKPQTHESLEFIPRL |
17 | Bombyx mori | Pyrokinin | Beta-SG neuropeptide | ||
| NP05045 | TDMKDESDRGAHSERGALWFGPRL |
24 | Bombyx mori | Pyrokinin | Diapause hormone | ||
| NP05046 | TMSFSPRL |
8 | Bombyx mori | Pyrokinin | Gamma-SG neuropeptide | 8475067#Sato Y., Oguchi M., Menjo N., Imai K., Saito H., Ikeda M., Isobe M., Yamashita O.; #Precursor polyprotein for multiple neuropeptides secreted from the suboesophageal ganglion of the silkworm Bombyx mori: characterization of the cDNA encoding the diapause hormone precursor and identification of additional peptides.; #Proc. Natl. Acad. Sci. U.S.A. 90:3251-3255(1993). | |
| NP05047 | LSEDMPATPADQEMYQPDPEEMESRTRYFSPRL |
33 | Bombyx mori | Pyrokinin | Pheromone biosynthesis-activating neuropeptide I | 2775285#Kitamura A., Nagasawa H., Kataoka H., Inoue T., Matsumoto S., Ando T., Suzuki A.; #Amino acid sequence of pheromone-biosynthesis-activating neuropeptide (PBAN) of the silkworm, Bombyx mori.; #Biochem. Biophys. Res. Commun. 163:520-526(1989).$8512566#Nachman R.J., Kuniyoshi H., Roberts V.A., Holman G.M., Suzuki A.; #Active conformation of the pyrokinin/PBAN neuropeptide family for pheromone biosynthesis in the silkworm.; #Biochem. Biophys. Res. Commun. 193:661-666(1993). | |
| NP05048 | RLSEDMPATPADQEMYQPDPEEMESRTRYFSPRL |
34 | Bombyx mori | Pyrokinin | Pheromone biosynthesis-activating neuropeptide II | 1368584#Kitamura A., Nagasawa H., Kataoka H., Ando T., Suzuki A.; #Amino acid sequence of pheromone biosynthesis activating neuropeptide-II (PBAN-II) of the silkmoth, Bombyx mori.; #Agric. Biol. Chem. 54:2495-2497(1990). | |
| NP05049 | DEGGTQYTPRL |
11 | Carausius morosus | Pyrokinin | Pyrokinin-1 | #Predel R., Kellner R., Gaede G.; #Myotropic neuropeptides from the retrocerebral complex of the stick insect, Carausius morosus (Phasmatodea: Lonchodidae).; #Eur. J. Entomol. 96:275-278(1999). | |
| NP05050 | DHMSHDVYSPRL |
12 | Celatoblatta sp. | Pyrokinin | Pyrokinin-4 | 15626499#Predel R., Gaede G.; #Peptidomics of neurohemal organs from species of the cockroach family Blattidae: how do neuropeptides of closely related species differ?; #Peptides 26:3-9(2005). | |
| NP05051 | SDPEVPGMWFGPRL |
14 | Celatoblatta sp. | Pyrokinin | Pyrokinin-6 | 15626499#Predel R., Gaede G.; #Peptidomics of neurohemal organs from species of the cockroach family Blattidae: how do neuropeptides of closely related species differ?; #Peptides 26:3-9(2005). | |
| NP05052 | GGGGSGETSGMWFGPRL |
17 | Cryptocercus darwini | Pyrokinin | Pyrokinin-5 | 19257902#Roth S., Fromm B., Gaede G., Predel R.; #A proteomic approach for studying insect phylogeny: CAPA peptides of ancient insect taxa (Dictyoptera, Blattoptera) as a test case.; #BMC Evol. Biol. 9:50-50(2009). | |
| NP05053 | EGSGSGETSGMWFGPRL |
17 | Cryptocercus kyebangensis | Pyrokinin | Pyrokinin-5 | 19257902#Roth S., Fromm B., Gaede G., Predel R.; #A proteomic approach for studying insect phylogeny: CAPA peptides of ancient insect taxa (Dictyoptera, Blattoptera) as a test case.; #BMC Evol. Biol. 9:50-50(2009). | |
| NP05054 | SGETSGEGNGMWFGPRL |
17 | Cyrtotria poduriformis | Pyrokinin | Pyrokinin-5 | 19257902#Roth S., Fromm B., Gaede G., Predel R.; #A proteomic approach for studying insect phylogeny: CAPA peptides of ancient insect taxa (Dictyoptera, Blattoptera) as a test case.; #BMC Evol. Biol. 9:50-50(2009). | |
| NP05055 | AGPSATTGVWFGPRL |
15 | Delia radicum | Pyrokinin | CAPA-Pyrokinin | 22848525#Zoephel J., Reiher W., Rexer K.-H., Kahnt J., Wegener C.; #Peptidomics of the agriculturally damaging larval stage of the cabbage root fly Delia radicum (Diptera: Anthomyiidae).; #PLoS ONE 7:E41543-E41543(2012). | |
| NP05056 | GPSATTGVWFGPRL |
14 | Delia radicum | Pyrokinin | CAPA-Pyrokinin(2-15) | 22848525#Zoephel J., Reiher W., Rexer K.-H., Kahnt J., Wegener C.; #Peptidomics of the agriculturally damaging larval stage of the cabbage root fly Delia radicum (Diptera: Anthomyiidae).; #PLoS ONE 7:E41543-E41543(2012). | |
| NP05057 | SVQFKPRL |
8 | Delia radicum | Pyrokinin | HUG-Pyrokinin | 20869420#Audsley N., Matthews H.J., Down R.E., Weaver R.J.; #Neuropeptides associated with the central nervous system of the cabbage root fly, Delia radicum (L).; #Peptides 32:434-440(2011).$22848525#Zoephel J., Reiher W., Rexer K.-H., Kahnt J., Wegener C.; #"Peptidomics of the agriculturally damaging larval stage of the cabbage root fly Delia radicum (Diptera: Anthomyiidae)."; #PLoS ONE 7:E41543-E41543(2012). | |
| NP05058 | DGDMSGEGKGMWFGPRL |
17 | Derocalymma cruralis | Pyrokinin | Pyrokinin-5 | 19257902#Roth S., Fromm B., Gaede G., Predel R.; #A proteomic approach for studying insect phylogeny: CAPA peptides of ancient insect taxa (Dictyoptera, Blattoptera) as a test case.; #BMC Evol. Biol. 9:50-50(2009).$ #Predel R.; # #Submitted (SEP-2005) to UniProtKB. | |
| NP05059 | TGDMSGEGKGMWFGPRL |
17 | Derocalymma versicolor | Pyrokinin | Pyrokinin-5 | 19257902#Roth S., Fromm B., Gaede G., Predel R.; #A proteomic approach for studying insect phylogeny: CAPA peptides of ancient insect taxa (Dictyoptera, Blattoptera) as a test case.; #BMC Evol. Biol. 9:50-50(2009).$ #Predel R.; # #Submitted (SEP-2005) to UniProtKB. | |
| NP05060 | GGGGSGETSGMWFGPRL |
17 | Deropeltis atra | Pyrokinin | Pyrokinin-5 | 19257902#Roth S., Fromm B., Gaede G., Predel R.; #A proteomic approach for studying insect phylogeny: CAPA peptides of ancient insect taxa (Dictyoptera, Blattoptera) as a test case.; #BMC Evol. Biol. 9:50-50(2009). | |
| NP05061 | DHLPHDVYSPRL |
12 | Deropeltis cf. erythrocephala JT-2004 | Pyrokinin | Pyrokinin-4 | 15626499#Predel R., Gaede G.; #Peptidomics of neurohemal organs from species of the cockroach family Blattidae: how do neuropeptides of closely related species differ?; #Peptides 26:3-9(2005). | |
| NP05062 | SDPEVPGMWFGPRL |
14 | Deropeltis cf. erythrocephala JT-2004 | Pyrokinin | Pyrokinin-6 | 15626499#Predel R., Gaede G.; #Peptidomics of neurohemal organs from species of the cockroach family Blattidae: how do neuropeptides of closely related species differ?; #Peptides 26:3-9(2005). | |
| NP05063 | DHLPHDVYSPRL |
12 | Deropeltis erythrocephala | Pyrokinin | Pyrokinin-4 | 15626499#Predel R., Gaede G.; #Peptidomics of neurohemal organs from species of the cockroach family Blattidae: how do neuropeptides of closely related species differ?; #Peptides 26:3-9(2005). | |
| NP05064 | GGGGSGETSGMWFGPRL |
17 | Deropeltis erythrocephala | Pyrokinin | Pyrokinin-5 | 19257902#Roth S., Fromm B., Gaede G., Predel R.; #A proteomic approach for studying insect phylogeny: CAPA peptides of ancient insect taxa (Dictyoptera, Blattoptera) as a test case.; #BMC Evol. Biol. 9:50-50(2009). | |
| NP05065 | SDPEVPGMWFGPRL |
14 | Deropeltis erythrocephala | Pyrokinin | Pyrokinin-6 | 15626499#Predel R., Gaede G.; #Peptidomics of neurohemal organs from species of the cockroach family Blattidae: how do neuropeptides of closely related species differ?; #Peptides 26:3-9(2005). | |
| NP05066 | GGGGSGETSGMWFGPRL |
17 | Deropeltis integerrima | Pyrokinin | Pyrokinin-5 | 19257902#Roth S., Fromm B., Gaede G., Predel R.; #A proteomic approach for studying insect phylogeny: CAPA peptides of ancient insect taxa (Dictyoptera, Blattoptera) as a test case.; #BMC Evol. Biol. 9:50-50(2009). | |
| NP05067 | DHLPHDVYSPRL |
12 | Deropeltis sp. | Pyrokinin | Pyrokinin-4 | 15626499#Predel R., Gaede G.; #Peptidomics of neurohemal organs from species of the cockroach family Blattidae: how do neuropeptides of closely related species differ?; #Peptides 26:3-9(2005). | |
| NP05068 | SDPEVPGMWFGPRL |
14 | Deropeltis sp. | Pyrokinin | Pyrokinin-6 | 15626499#Predel R., Gaede G.; #Peptidomics of neurohemal organs from species of the cockroach family Blattidae: how do neuropeptides of closely related species differ?; #Peptides 26:3-9(2005). | |
| NP05069 | SGETSGEGNGMWFGPRL |
17 | Diploptera punctata | Pyrokinin | Pyrokinin-5 | 19257902#Roth S., Fromm B., Gaede G., Predel R.; #A proteomic approach for studying insect phylogeny: CAPA peptides of ancient insect taxa (Dictyoptera, Blattoptera) as a test case.; #BMC Evol. Biol. 9:50-50(2009).$ #Predel R.; # #Submitted (SEP-2005) to UniProtKB. | |
| NP05070 | GANMGLYAFPRV |
12 | Drosophila melanogaster | Pyrokinin | CAP-1 | 12171930#Baggerman G., Cerstiaens A., De Loof A., Schoofs L.; #Peptidomics of the larval Drosophila melanogaster central nervous system.; #J. Biol. Chem. 277:40368-40374(2002). | |
| NP05071 | ASGLVAFPRV |
10 | Drosophila melanogaster | Pyrokinin | CAP-2 | 12171930#Baggerman G., Cerstiaens A., De Loof A., Schoofs L.; #Peptidomics of the larval Drosophila melanogaster central nervous system.; #J. Biol. Chem. 277:40368-40374(2002). | |
| NP05072 | TGPSASSGLWFGPRL |
15 | Drosophila melanogaster | Pyrokinin | CAP-3 | ||
| NP05073 | QLQSNGEPAYRVRTPRL |
17 | Drosophila melanogaster | Pyrokinin | Hug-gamma (Potential) | ||
| NP05074 | SVPFKPRL |
8 | Drosophila melanogaster | Pyrokinin | pyrokinin-2 | 12171930#Baggerman G., Cerstiaens A., De Loof A., Schoofs L.; #Peptidomics of the larval Drosophila melanogaster central nervous system.; #J. Biol. Chem. 277:40368-40374(2002).$14690519#Verleyen P., Baggerman G., Wiehart U., Schoeters E., Van Lommel A., De Loof A., Schoofs L.; #Expression of a novel neuropeptide, NVGTLARDFQLPIPNamide, in the larval and adult brain of Drosophila melanogaster.; #J. Neurochem. 88:311-319(2004). | |
| NP05075 | GANMGLYAFPRV |
12 | Drosophila pseudoobscura pseudoobscura | Pyrokinin | CAP-1 (By similarity) | ||
| NP05076 | AGLVAFPRV |
9 | Drosophila pseudoobscura pseudoobscura | Pyrokinin | CAP-2 (By similarity) | ||
| NP05077 | TGPSASSGLWFGPRL |
15 | Drosophila pseudoobscura pseudoobscura | Pyrokinin | CAP-3 (By similarity) | ||
| NP05078 | FGETSGETKGMWFGPRL |
17 | Elliptorhina sp. | Pyrokinin | Pyrokinin-5 | 19257902#Roth S., Fromm B., Gaede G., Predel R.; #A proteomic approach for studying insect phylogeny: CAPA peptides of ancient insect taxa (Dictyoptera, Blattoptera) as a test case.; #BMC Evol. Biol. 9:50-50(2009). | |
| NP05079 | SASSGESSGMWFGPRL |
16 | Ergaula capucina | Pyrokinin | Pyrokinin-5 | 19257902#Roth S., Fromm B., Gaede G., Predel R.; #A proteomic approach for studying insect phylogeny: CAPA peptides of ancient insect taxa (Dictyoptera, Blattoptera) as a test case.; #BMC Evol. Biol. 9:50-50(2009). | |
| NP05080 | AGESSNEAKGMWFGPRL |
17 | Eublaberus distanti | Pyrokinin | Pyrokinin-5 | 19257902#Roth S., Fromm B., Gaede G., Predel R.; #A proteomic approach for studying insect phylogeny: CAPA peptides of ancient insect taxa (Dictyoptera, Blattoptera) as a test case.; #BMC Evol. Biol. 9:50-50(2009). | |
| NP05081 | AGESSNEAKGMWFGPRL |
17 | Eublaberus posticus | Pyrokinin | Pyrokinin-5 | 19257902#Roth S., Fromm B., Gaede G., Predel R.; #A proteomic approach for studying insect phylogeny: CAPA peptides of ancient insect taxa (Dictyoptera, Blattoptera) as a test case.; #BMC Evol. Biol. 9:50-50(2009). | |
| NP05082 | AGESSNEAKGMWFGPRL |
17 | Eublaberus sp. | Pyrokinin | Pyrokinin-5 | 19257902#Roth S., Fromm B., Gaede G., Predel R.; #A proteomic approach for studying insect phylogeny: CAPA peptides of ancient insect taxa (Dictyoptera, Blattoptera) as a test case.; #BMC Evol. Biol. 9:50-50(2009). | |
| NP05083 | DHLPHDVYSPRL |
12 | Eurycotis floridana | Pyrokinin | Pyrokinin-4 | 15626499#Predel R., Gaede G.; #Peptidomics of neurohemal organs from species of the cockroach family Blattidae: how do neuropeptides of closely related species differ?; #Peptides 26:3-9(2005). | |
| NP05084 | GGGGSGETSGMWFGPRL |
17 | Eurycotis floridana | Pyrokinin | Pyrokinin-5 | 19257902#Roth S., Fromm B., Gaede G., Predel R.; #A proteomic approach for studying insect phylogeny: CAPA peptides of ancient insect taxa (Dictyoptera, Blattoptera) as a test case.; #BMC Evol. Biol. 9:50-50(2009). | |
| NP05085 | GDSEVPGMWFGPRL |
14 | Eurycotis floridana | Pyrokinin | Pyrokinin-6 | 15626499#Predel R., Gaede G.; #Peptidomics of neurohemal organs from species of the cockroach family Blattidae: how do neuropeptides of closely related species differ?; #Peptides 26:3-9(2005). | |
| NP05086 | FGETSGETKGMWFGPRL |
17 | Gromphadorhina grandidieri | Pyrokinin | Pyrokinin-5 | 19257902#Roth S., Fromm B., Gaede G., Predel R.; #A proteomic approach for studying insect phylogeny: CAPA peptides of ancient insect taxa (Dictyoptera, Blattoptera) as a test case.; #BMC Evol. Biol. 9:50-50(2009). | |
| NP05087 | FGETSGETKGMWFGPRL |
17 | Gromphadorina portentosa | Pyrokinin | Pyrokinin-5 | 19257902#Roth S., Fromm B., Gaede G., Predel R.; #A proteomic approach for studying insect phylogeny: CAPA peptides of ancient insect taxa (Dictyoptera, Blattoptera) as a test case.; #BMC Evol. Biol. 9:50-50(2009). | |
| NP05088 | AGDTSSEAKGMWFGPRL |
17 | Gyna cf. cafforum | Pyrokinin | Pyrokinin-5 | 19257902#Roth S., Fromm B., Gaede G., Predel R.; #A proteomic approach for studying insect phylogeny: CAPA peptides of ancient insect taxa (Dictyoptera, Blattoptera) as a test case.; #BMC Evol. Biol. 9:50-50(2009). | |
| NP05089 | AGDTSSEAKGMWFGPRL |
17 | Gyna lurida | Pyrokinin | Pyrokinin-5 | 19257902#Roth S., Fromm B., Gaede G., Predel R.; #A proteomic approach for studying insect phylogeny: CAPA peptides of ancient insect taxa (Dictyoptera, Blattoptera) as a test case.; #BMC Evol. Biol. 9:50-50(2009). | |
| NP05090 | VIFTPKL |
7 | Helicoverpa assulta | Pyrokinin | Alpha-SG neuropeptide (Potential) | ||
| NP05091 | SLAYDDKSFENVEFTPRL |
18 | Helicoverpa assulta | Pyrokinin | Beta-SG neuropeptide (Potential) | ||
| NP05092 | NDVKDGAASGAHSDRLGLWFGPRL |
24 | Helicoverpa assulta | Pyrokinin | Diapause hormone homolog (Potential) | ||
| NP05093 | TMNFSPRL |
8 | Helicoverpa assulta | Pyrokinin | Gamma-SG neuropeptide (Potential) | ||
| NP05094 | LSDDMPATPADQEMYRQDPEQIDSRTKYFSPRL |
33 | Helicoverpa assulta | Pyrokinin | Pheromone biosynthesis-activating neuropeptide | ||
| NP05095 | VIFTPKL |
7 | Helicoverpa zea | Pyrokinin | Alpha-SG neuropeptide (Potential) | ||
| NP05096 | SLAYDDKSFENVEFTPRL |
18 | Helicoverpa zea | Pyrokinin | Beta-SG neuropeptide (Potential) | ||
| NP05097 | NDVKDGAASGAHSDRLGLWFGPRL |
24 | Helicoverpa zea | Pyrokinin | Diapause hormone homolog (Potential) | ||
| NP05098 | TMNFSPRL |
8 | Helicoverpa zea | Pyrokinin | Gamma-SG neuropeptide (Potential) | ||
| NP05099 | LSDDMPATPADQEMYRQDPEQIDSRTKYFSPRL |
33 | Helicoverpa zea | Pyrokinin | Pheromone biosynthesis-activating neuropeptide | 17802237#Raina A.K., Jaffe H., Kempe T.G., Keim P., Blacher R.W., Fales H.M., Riley C.T., Klun J.A., Ridgway R.L., Hayes D.K.; #Identification of a neuropeptide hormone that regulates sex pheromone production in female moths.; #Science 244:796-798(1989). | |
| NP05100 | DGYTPRL |
7 | Hemilobophasma montaguense | Pyrokinin | Pyrokinin-1 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
| NP05101 | SPPFAPRL |
8 | Hemilobophasma montaguense | Pyrokinin | Pyrokinin-2 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
| NP05102 | DPPFSPRL |
8 | Hemilobophasma montaguense | Pyrokinin | Pyrokinin-3 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
| NP05103 | SGGGDGSGMWFGPRL |
15 | Hemilobophasma montaguense | Pyrokinin | CAPA-Pyrokinin | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
| NP05104 | SGETSGEGNGMWFGPRL |
17 | Hostilia carinata | Pyrokinin | Pyrokinin-5 | 19257902#Roth S., Fromm B., Gaede G., Predel R.; #A proteomic approach for studying insect phylogeny: CAPA peptides of ancient insect taxa (Dictyoptera, Blattoptera) as a test case.; #BMC Evol. Biol. 9:50-50(2009). | |
| NP05105 | DGYTPRL |
7 | Karoophasma biedouwense | Pyrokinin | Pyrokinin-1 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
| NP05106 | SPPFAPRL |
8 | Karoophasma biedouwense | Pyrokinin | Pyrokinin-2 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
| NP05107 | DPPFSPRL |
8 | Karoophasma biedouwense | Pyrokinin | Pyrokinin-3 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
| NP05108 | SGGGDGSGMWFGPRL |
15 | Karoophasma biedouwense | Pyrokinin | CAPA-Pyrokinin | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
| NP05109 | DGYTPRL |
7 | Karoophasma botterkloofense | Pyrokinin | Pyrokinin-1 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
| NP05110 | SPPFAPRL |
8 | Karoophasma botterkloofense | Pyrokinin | Pyrokinin-2 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
| NP05111 | DPPFSPRL |
8 | Karoophasma botterkloofense | Pyrokinin | Pyrokinin-3 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
| NP05112 | SGGGDGSGMWFGPRL |
15 | Karoophasma botterkloofense | Pyrokinin | CAPA-Pyrokinin | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
| NP05113 | GGETSGETKGMWFGPRL |
17 | Laxta sp. | Pyrokinin | Pyrokinin-5 | #Predel R.; ##Submitted (SEP-2005) to UniProtKB. | |
| NP05114 | DGYTPRL |
7 | Lobatophasma redelinghuysense | Pyrokinin | Pyrokinin-1 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
| NP05115 | SPPFAPRL |
8 | Lobatophasma redelinghuysense | Pyrokinin | Pyrokinin-2 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
| NP05116 | DPPFSPRL |
8 | Lobatophasma redelinghuysense | Pyrokinin | Pyrokinin-3 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
| NP05117 | SSGGGDGSGMWFGPRL |
16 | Lobatophasma redelinghuysense | Pyrokinin | CAPA-Pyrokinin | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
| NP05118 | GSGGSGEANGMWFGPRL |
17 | Loboptera decipiens | Pyrokinin | Pyrokinin-5 | 19257902#Roth S., Fromm B., Gaede G., Predel R.; #A proteomic approach for studying insect phylogeny: CAPA peptides of ancient insect taxa (Dictyoptera, Blattoptera) as a test case.; #BMC Evol. Biol. 9:50-50(2009). | |
| NP05119 | GAVPAAQFSPRL |
12 | Locusta migratoria | Pyrokinin | Locustamyotropin-1 | 1974346#Schoofs L., Holman G.M., Hayes T.K., Tips A., Nachman R.J., Vandesande F., de Loof A.; #Isolation, identification and synthesis of locustamyotropin (Lom-MT), a novel biologically active insect peptide.; #Peptides 11:427-433(1990). | |
| NP05120 | EGDFTPRL |
8 | Locusta migratoria | Pyrokinin | Locustamyotropin-2 | #Schoofs L., Holman G.M., Hayes T.K., Nachman R.J., de Loof A.; #Isolation, identification and synthesis of locustamyotropin II, an additional neuropeptide of Locusta migratoria. Member of the cephalomyotropic peptide family.; #Insect Biochem. 20:479-484(1990). | |
| NP05121 | RQQPFVPRL |
9 | Locusta migratoria | Pyrokinin | Locustamyotropin-3 | #Schoofs L., Holman G.M., Hayes T.K., Nachman R.J., Kochansky J.P., de Loof A.; #Isolation, identification and synthesis of locustamyotropin III and IV, two additional neuropeptides of Locusta migratoria: members of the locustamyotropin peptide family.; #Insect Biochem. Mol. Biol. 22:447-452(1992). | |
| NP05122 | RLHQNGMPFSPRL |
13 | Locusta migratoria | Pyrokinin | Locustamyotropin-4 | #Schoofs L., Holman G.M., Hayes T.K., Nachman R.J., Kochansky J.P., de Loof A.; #Isolation, identification and synthesis of locustamyotropin III and IV, two additional neuropeptides of Locusta migratoria: members of the locustamyotropin peptide family.; #Insect Biochem. Mol. Biol. 22:447-452(1992). | |
| NP05123 | QDSGDGWPQQPFVPRL |
16 | Locusta migratoria | Pyrokinin | Locustapyrokinin-1 | 2026322#Schoofs L., Holman G.M., Hayes T.K., Nachman R.J., de Loof A.; #Isolation, primary structure, and synthesis of locustapyrokinin: a myotropic peptide of Locusta migratoria.; #Gen. Comp. Endocrinol. 81:97-104(1991). | |
| NP05124 | QSVPTFTPRL |
10 | Locusta migratoria | Pyrokinin | Locustapyrokinin-2 | 7903606#Schoofs L., Holman G.M., Nachman R., Proost P., van Damme J., de Loof A.; #Isolation, identification and synthesis of locustapyrokinin II from Locusta migratoria, another member of the FXPRL-amide peptide family.; #Comp. Biochem. Physiol. 106C:103-109(1993). | |
| NP05125 | DGGEPAAPLWFGPRV |
15 | Locusta migratoria | Pyrokinin | Pyrokinin | 12504101#Clynen E., Huybrechts J., De Loof A., Schoofs L.; #Mass spectrometric analysis of the perisympathetic organs in locusts: identification of novel periviscerokinins.; #Biochem. Biophys. Res. Commun. 300:422-428(2003). | |
| NP05126 | GGESSNEAKGMWFGPRL |
17 | Lucihormetica grossei | Pyrokinin | Pyrokinin-5 | 19257902#Roth S., Fromm B., Gaede G., Predel R.; #A proteomic approach for studying insect phylogeny: CAPA peptides of ancient insect taxa (Dictyoptera, Blattoptera) as a test case.; #BMC Evol. Biol. 9:50-50(2009). | |
| NP05127 | GGESSNEAKGMWFGPRL |
17 | Lucihormetica subcincta | Pyrokinin | Pyrokinin-5 | 19257902#Roth S., Fromm B., Gaede G., Predel R.; #A proteomic approach for studying insect phylogeny: CAPA peptides of ancient insect taxa (Dictyoptera, Blattoptera) as a test case.; #BMC Evol. Biol. 9:50-50(2009). | |
| NP05128 | GGESSNEAKGMWFGPRL |
17 | Lucihormetica verrucosa | Pyrokinin | Pyrokinin-5 | 19257902#Roth S., Fromm B., Gaede G., Predel R.; #A proteomic approach for studying insect phylogeny: CAPA peptides of ancient insect taxa (Dictyoptera, Blattoptera) as a test case.; #BMC Evol. Biol. 9:50-50(2009). | |
| NP05129 | LADDMPATMADQEVYRPEPEQIDSRNKYFSPRL |
33 | Lymantria dispar | Pyrokinin | Pheromone biosynthesis-activating neuropeptide | ||
| NP05130 | VIFTPKL |
7 | Mamestra brassicae | Pyrokinin | Alpha-SG neuropeptide (Potential) | 9684333#Jacquin-Joly E., Burnet M., Francois M.-C., Ammar D., Nagnan-Meillour P., Descoins C.;#cDNA cloning and sequence determination of the pheromone biosynthesis activating neuropeptide of Mamestra brassicae: a new member of the PBAN family.;#Insect Biochem. Mol. Biol. 28:251-258(1998). | |
| NP05131 | SLAYDDKVFENVEFTPRL |
18 | Mamestra brassicae | Pyrokinin | Beta-SG neuropeptide (Potential) | 9684333#Jacquin-Joly E., Burnet M., Francois M.-C., Ammar D., Nagnan-Meillour P., Descoins C.;#cDNA cloning and sequence determination of the pheromone biosynthesis activating neuropeptide of Mamestra brassicae: a new member of the PBAN family.;#Insect Biochem. Mol. Biol. 28:251-258(1998). | |
| NP05132 | TMNFSPRL |
8 | Mamestra brassicae | Pyrokinin | Gamma-SG neuropeptide (Potential) | 9684333#Jacquin-Joly E., Burnet M., Francois M.-C., Ammar D., Nagnan-Meillour P., Descoins C.;#cDNA cloning and sequence determination of the pheromone biosynthesis activating neuropeptide of Mamestra brassicae: a new member of the PBAN family.;#Insect Biochem. Mol. Biol. 28:251-258(1998). | |
| NP05133 | LADDMPATPADQEMYRPDPEQIDSRTKYFSPRL |
33 | Mamestra brassicae | Pyrokinin | Pheromone biosynthesis-activating neuropeptide | 9684333#Jacquin-Joly E., Burnet M., Francois M.-C., Ammar D., Nagnan-Meillour P., Descoins C.;#cDNA cloning and sequence determination of the pheromone biosynthesis activating neuropeptide of Mamestra brassicae: a new member of the PBAN family.;#Insect Biochem. Mol. Biol. 28:251-258(1998). | |
| NP05134 | DGYTPRL |
7 | Mantophasma kudubergense | Pyrokinin | Pyrokinin-1 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
| NP05135 | SPPFAPRL |
8 | Mantophasma kudubergense | Pyrokinin | Pyrokinin-2 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
| NP05136 | DPPFAPRM |
8 | Mantophasma kudubergense | Pyrokinin | Pyrokinin-3 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
| NP05137 | SGGGEGSGMWFGPRL |
15 | Mantophasma kudubergense | Pyrokinin | CAPA-Pyrokinin | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
| NP05138 | GGSGSGETSGMWFGPRL |
17 | Mastotermes darwiniensis | Pyrokinin | Pyrokinin-5 | 19257902#Roth S., Fromm B., Gaede G., Predel R.; #A proteomic approach for studying insect phylogeny: CAPA peptides of ancient insect taxa (Dictyoptera, Blattoptera) as a test case.; #BMC Evol. Biol. 9:50-50(2009). | |
| NP05139 | AGPSATTGVWFGPRL |
15 | Musca domestica | Pyrokinin | Pyrokinin | 14706527#Predel R., Russell W.K., Tichy S.E., Russell D.H., Nachman R.J.; #Mass spectrometric analysis of putative capa-gene products in Musca domestica and Neobellieria bullata.; #Peptides 24:1487-1491(2003). | |
| NP05140 | KLSYDDKVFENVEFTPRL |
18 | Mythimna separata | Pyrokinin | Pheromonotropin | 1734867#Matsumoto S., Fonagy A., Kurihara M., Uchiumi K., Nagamine T., Chijimatsu M., Mitsui T.; #Isolation and primary structure of a novel pheromonotropic neuropeptide structurally related to leucopyrokinin from the armyworm larvae, Pseudaletia separata.; #Biochem. Biophys. Res. Commun. 182:534-539(1992). | |
| NP05141 | DGYTPRL |
7 | Namaquaphasma ookiepense | Pyrokinin | Pyrokinin-1 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
| NP05142 | SPPFAPRL |
8 | Namaquaphasma ookiepense | Pyrokinin | Pyrokinin-2 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
| NP05143 | DPPFSPRL |
8 | Namaquaphasma ookiepense | Pyrokinin | Pyrokinin-3 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
| NP05144 | SGGGEGSGMWFGPRL |
15 | Namaquaphasma ookiepense | Pyrokinin | CAPA-Pyrokinin | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
| NP05145 | DHLPHDVYSPRL |
12 | Neostylopyga rhombifolia | Pyrokinin | Pyrokinin-4 | 15626499#Predel R., Gaede G.; #Peptidomics of neurohemal organs from species of the cockroach family Blattidae: how do neuropeptides of closely related species differ?; #Peptides 26:3-9(2005). | |
| NP05146 | GGGGSGETSGMWFGPRL |
17 | Neostylopyga rhombifolia | Pyrokinin | Pyrokinin-5 | 19257902#Roth S., Fromm B., Gaede G., Predel R.; #A proteomic approach for studying insect phylogeny: CAPA peptides of ancient insect taxa (Dictyoptera, Blattoptera) as a test case.; #BMC Evol. Biol. 9:50-50(2009). | |
| NP05147 | SDPEVPGMWFGPRL |
14 | Neostylopyga rhombifolia | Pyrokinin | Pyrokinin-6 | 15626499#Predel R., Gaede G.; #Peptidomics of neurohemal organs from species of the cockroach family Blattidae: how do neuropeptides of closely related species differ?; #Peptides 26:3-9(2005). | |
| NP05148 | DGYTPRL |
7 | Pachyphasma brandbergense | Pyrokinin | Pyrokinin-1 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
| NP05149 | SPPFAPRL |
8 | Pachyphasma brandbergense | Pyrokinin | Pyrokinin-2 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
| NP05150 | DPPFAPRM |
8 | Pachyphasma brandbergense | Pyrokinin | Pyrokinin-3 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
| NP05151 | AELPQGLWVRPRLG |
14 | Pachyphasma brandbergense | Pyrokinin | Pyrokinin-4 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
| NP05152 | NSGGGEGSGMWFGPRL |
16 | Pachyphasma brandbergense | Pyrokinin | CAPA-Pyrokinin | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
| NP05153 | GGETGNDAKAMWFGPRL |
17 | Panchlora sp. | Pyrokinin | Pyrokinin-5 | 19257902#Roth S., Fromm B., Gaede G., Predel R.; #A proteomic approach for studying insect phylogeny: CAPA peptides of ancient insect taxa (Dictyoptera, Blattoptera) as a test case.; #BMC Evol. Biol. 9:50-50(2009). | |
| NP05154 | GGETGSDAKAMWFGPRL |
17 | Panchlora viridis | Pyrokinin | Pyrokinin-5 | 19257902#Roth S., Fromm B., Gaede G., Predel R.; #A proteomic approach for studying insect phylogeny: CAPA peptides of ancient insect taxa (Dictyoptera, Blattoptera) as a test case.; #BMC Evol. Biol. 9:50-50(2009).$ #Predel R.; # #Submitted (SEP-2005) to UniProtKB. | |
| NP05155 | GGETSGEGKGMWFGPRL |
17 | Panesthia sp. | Pyrokinin | Pyrokinin-5 | 19257902#Roth S., Fromm B., Gaede G., Predel R.; #A proteomic approach for studying insect phylogeny: CAPA peptides of ancient insect taxa (Dictyoptera, Blattoptera) as a test case.; #BMC Evol. Biol. 9:50-50(2009). | |
| NP05156 | HTAGFIPRL |
9 | Periplaneta americana | Pyrokinin | Pyrokinin-1 | 9210163#Predel R., Kellner R., Kaufmann R., Penzlin H., Gaede G.; #Isolation and structural elucidation of two pyrokinins from the retrocerebral complex of the American cockroach.; #Peptides 18:473-478(1997). | |
| NP05157 | SPPFAPRL |
8 | Periplaneta americana | Pyrokinin | Pyrokinin-2 | 9210163#Predel R., Kellner R., Kaufmann R., Penzlin H., Gaede G.; #Isolation and structural elucidation of two pyrokinins from the retrocerebral complex of the American cockroach.; #Peptides 18:473-478(1997). | |
| NP05158 | LVPFRPRL |
8 | Periplaneta americana | Pyrokinin | Pyrokinin-3 | 10196736#Predel R., Kellner R., Nachman R.J., Holman G.M., Rapus J., Gaede G.; #Differential distribution of pyrokinin-isoforms in cerebral and abdominal neurohemal organs of the American cockroach.; #Insect Biochem. Mol. Biol. 29:139-144(1999). | |
| NP05159 | DHLPHDVYSPRL |
12 | Periplaneta americana | Pyrokinin | Pyrokinin-4 | 10196736#Predel R., Kellner R., Nachman R.J., Holman G.M., Rapus J., Gaede G.; #Differential distribution of pyrokinin-isoforms in cerebral and abdominal neurohemal organs of the American cockroach.; #Insect Biochem. Mol. Biol. 29:139-144(1999). | |
| NP05160 | GGGGSGETSGMWFGPRL |
17 | Periplaneta americana | Pyrokinin | Pyrokinin-5 | 10196736#Predel R., Kellner R., Nachman R.J., Holman G.M., Rapus J., Gaede G.; #Differential distribution of pyrokinin-isoforms in cerebral and abdominal neurohemal organs of the American cockroach.; #Insect Biochem. Mol. Biol. 29:139-144(1999).$19257902#Roth S., Fromm B., Gaede G., Predel R.; #"A proteomic approach for studying insect phylogeny: CAPA peptides of ancient insect taxa (Dictyoptera, Blattoptera) as a test case."; #BMC Evol. Biol. 9:50-50(2009). | |
| NP05161 | SESEVPGMWFGPRL |
14 | Periplaneta americana | Pyrokinin | Pyrokinin-6 | 10723010#Predel R., Eckert M.; #Tagma-specific distribution of FXPRLamides in the nervous system of the American cockroach.; #J. Comp. Neurol. 419:352-363(2000). | |
| NP05162 | DHLPHDVYSPRL |
12 | Periplaneta australasiae | Pyrokinin | Pyrokinin-4 | 15626499#Predel R., Gaede G.; #Peptidomics of neurohemal organs from species of the cockroach family Blattidae: how do neuropeptides of closely related species differ?; #Peptides 26:3-9(2005). | |
| NP05163 | GGGGSGETSGMWFGPRL |
17 | Periplaneta australasiae | Pyrokinin | Pyrokinin-5 | 19257902#Roth S., Fromm B., Gaede G., Predel R.; #A proteomic approach for studying insect phylogeny: CAPA peptides of ancient insect taxa (Dictyoptera, Blattoptera) as a test case.; #BMC Evol. Biol. 9:50-50(2009). | |
| NP05164 | NDPEVPGMWFGPRL |
14 | Periplaneta australasiae | Pyrokinin | Pyrokinin-6 | 15626499#Predel R., Gaede G.; #Peptidomics of neurohemal organs from species of the cockroach family Blattidae: how do neuropeptides of closely related species differ?; #Peptides 26:3-9(2005). | |
| NP05165 | DHLSHDVYSPRL |
12 | Periplaneta brunnea | Pyrokinin | Pyrokinin-4 | 15626499#Predel R., Gaede G.; #Peptidomics of neurohemal organs from species of the cockroach family Blattidae: how do neuropeptides of closely related species differ?; #Peptides 26:3-9(2005). | |
| NP05166 | GGGGSGETSGMWFGPRL |
17 | Periplaneta brunnea | Pyrokinin | Pyrokinin-5 | 19257902#Roth S., Fromm B., Gaede G., Predel R.; #A proteomic approach for studying insect phylogeny: CAPA peptides of ancient insect taxa (Dictyoptera, Blattoptera) as a test case.; #BMC Evol. Biol. 9:50-50(2009). | |
| NP05167 | SDPEVPGMWFGPRL |
14 | Periplaneta brunnea | Pyrokinin | Pyrokinin-6 | 15626499#Predel R., Gaede G.; #Peptidomics of neurohemal organs from species of the cockroach family Blattidae: how do neuropeptides of closely related species differ?; #Peptides 26:3-9(2005). | |
| NP05168 | DHLSHDVYSPRL |
12 | Periplaneta fuliginosa | Pyrokinin | Pyrokinin-4 | 10723010#Predel R., Eckert M.; #Tagma-specific distribution of FXPRLamides in the nervous system of the American cockroach.; #J. Comp. Neurol. 419:352-363(2000).$15626499#Predel R., Gaede G.; #"Peptidomics of neurohemal organs from species of the cockroach family Blattidae: how do neuropeptides of closely related species differ?"; #Peptides 26:3-9(2005). | |
| NP05169 | GGGGSGETSGMWFGPRL |
17 | Periplaneta fuliginosa | Pyrokinin | Pyrokinin-5 | 19257902#Roth S., Fromm B., Gaede G., Predel R.; #A proteomic approach for studying insect phylogeny: CAPA peptides of ancient insect taxa (Dictyoptera, Blattoptera) as a test case.; #BMC Evol. Biol. 9:50-50(2009). | |
| NP05170 | SDPEVPGMWFGPRL |
14 | Periplaneta fuliginosa | Pyrokinin | Pyrokinin-6 | 15626499#Predel R., Gaede G.; #Peptidomics of neurohemal organs from species of the cockroach family Blattidae: how do neuropeptides of closely related species differ?; #Peptides 26:3-9(2005). | |
| NP05171 | SGETSGEGNGMWFGPRL |
17 | Perisphaeria aff. bicolor | Pyrokinin | Pyrokinin-5 | 19257902#Roth S., Fromm B., Gaede G., Predel R.; #A proteomic approach for studying insect phylogeny: CAPA peptides of ancient insect taxa (Dictyoptera, Blattoptera) as a test case.; #BMC Evol. Biol. 9:50-50(2009). | |
| NP05172 | SGETSGEGNGMWFGPRL |
17 | Perisphaeria cf. scabrella | Pyrokinin | Pyrokinin-5 | 19257902#Roth S., Fromm B., Gaede G., Predel R.; #A proteomic approach for studying insect phylogeny: CAPA peptides of ancient insect taxa (Dictyoptera, Blattoptera) as a test case.; #BMC Evol. Biol. 9:50-50(2009). | |
| NP05173 | SGETSGEGNGMWFGPRL |
17 | Perisphaeria cf. substylifera | Pyrokinin | Pyrokinin-5 | 19257902#Roth S., Fromm B., Gaede G., Predel R.; #A proteomic approach for studying insect phylogeny: CAPA peptides of ancient insect taxa (Dictyoptera, Blattoptera) as a test case.; #BMC Evol. Biol. 9:50-50(2009). | |
| NP05174 | SGETSGEGNGMWFGPRL |
17 | Perisphaeria ruficornis | Pyrokinin | Pyrokinin-5 | 19257902#Roth S., Fromm B., Gaede G., Predel R.; #A proteomic approach for studying insect phylogeny: CAPA peptides of ancient insect taxa (Dictyoptera, Blattoptera) as a test case.; #BMC Evol. Biol. 9:50-50(2009). | |
| NP05175 | SGETSGEGNGMWFGPRL |
17 | Perisphaeria virescens | Pyrokinin | Pyrokinin-5 | 19257902#Roth S., Fromm B., Gaede G., Predel R.; #A proteomic approach for studying insect phylogeny: CAPA peptides of ancient insect taxa (Dictyoptera, Blattoptera) as a test case.; #BMC Evol. Biol. 9:50-50(2009). | |
| NP05176 | SGETSGEGNGMWFGPRL |
17 | Pilema dubia | Pyrokinin | Pyrokinin-5 | 19257902#Roth S., Fromm B., Gaede G., Predel R.; #A proteomic approach for studying insect phylogeny: CAPA peptides of ancient insect taxa (Dictyoptera, Blattoptera) as a test case.; #BMC Evol. Biol. 9:50-50(2009). | |
| NP05177 | SASGGAGESSGMWFGPRL |
18 | Polyphaga aegyptiaca | Pyrokinin | Pyrokinin-5 | 19257902#Roth S., Fromm B., Gaede G., Predel R.; #A proteomic approach for studying insect phylogeny: CAPA peptides of ancient insect taxa (Dictyoptera, Blattoptera) as a test case.; #BMC Evol. Biol. 9:50-50(2009). | |
| NP05178 | DGYTPRL |
7 | Praedatophasma maraisi | Pyrokinin | Pyrokinin-1 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
| NP05179 | SPPFAPRL |
8 | Praedatophasma maraisi | Pyrokinin | Pyrokinin-2 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
| NP05180 | DPPFAPRM |
8 | Praedatophasma maraisi | Pyrokinin | Pyrokinin-3 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
| NP05181 | AELPQGLWVRPRL |
13 | Praedatophasma maraisi | Pyrokinin | Pyrokinin-4 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
| NP05182 | SGGGEGSGMWFGPRL |
15 | Praedatophasma maraisi | Pyrokinin | CAPA-Pyrokinin | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
| NP05183 | FGETSGETKGMWFGPRL |
17 | Princisia vanwaerbeki | Pyrokinin | Pyrokinin-5 | 19257902#Roth S., Fromm B., Gaede G., Predel R.; #A proteomic approach for studying insect phylogeny: CAPA peptides of ancient insect taxa (Dictyoptera, Blattoptera) as a test case.; #BMC Evol. Biol. 9:50-50(2009). | |
| NP05184 | DHLPHDVYSPRL |
12 | Pseudoderopeltis cf. bimaculata JT-2004 | Pyrokinin | Pyrokinin-4 | 15626499#Predel R., Gaede G.; #Peptidomics of neurohemal organs from species of the cockroach family Blattidae: how do neuropeptides of closely related species differ?; #Peptides 26:3-9(2005). | |
| NP05185 | GGGGSGETSGMWFGPRL |
17 | Pseudoderopeltis cf. bimaculata JT-2004 | Pyrokinin | Pyrokinin-5 | 19257902#Roth S., Fromm B., Gaede G., Predel R.; #A proteomic approach for studying insect phylogeny: CAPA peptides of ancient insect taxa (Dictyoptera, Blattoptera) as a test case.; #BMC Evol. Biol. 9:50-50(2009). | |
| NP05186 | SDPEVPGMWFGPRL |
14 | Pseudoderopeltis cf. bimaculata JT-2004 | Pyrokinin | Pyrokinin-6 | 15626499#Predel R., Gaede G.; #Peptidomics of neurohemal organs from species of the cockroach family Blattidae: how do neuropeptides of closely related species differ?; #Peptides 26:3-9(2005). | |
| NP05187 | DHLPHDVYSPRL |
12 | Pseudoderopeltis flavescens | Pyrokinin | Pyrokinin-4 | 15626499#Predel R., Gaede G.; #Peptidomics of neurohemal organs from species of the cockroach family Blattidae: how do neuropeptides of closely related species differ?; #Peptides 26:3-9(2005). | |
| NP05188 | GGGGGSGETSGMWFGPRL |
18 | Pseudoderopeltis flavescens | Pyrokinin | Pyrokinin-5 | 19257902#Roth S., Fromm B., Gaede G., Predel R.; #A proteomic approach for studying insect phylogeny: CAPA peptides of ancient insect taxa (Dictyoptera, Blattoptera) as a test case.; #BMC Evol. Biol. 9:50-50(2009). | |
| NP05189 | SDPEVPGMWFGPRL |
14 | Pseudoderopeltis flavescens | Pyrokinin | Pyrokinin-6 | 15626499#Predel R., Gaede G.; #Peptidomics of neurohemal organs from species of the cockroach family Blattidae: how do neuropeptides of closely related species differ?; #Peptides 26:3-9(2005). | |
| NP05190 | DHLPHDVYSPRL |
12 | Pseudoderopeltis foveolata | Pyrokinin | Pyrokinin-4 | 15626499#Predel R., Gaede G.; #Peptidomics of neurohemal organs from species of the cockroach family Blattidae: how do neuropeptides of closely related species differ?; #Peptides 26:3-9(2005). | |
| NP05191 | GGGGSGETSGMWFGPRL |
17 | Pseudoderopeltis foveolata | Pyrokinin | Pyrokinin-5 | 19257902#Roth S., Fromm B., Gaede G., Predel R.; #A proteomic approach for studying insect phylogeny: CAPA peptides of ancient insect taxa (Dictyoptera, Blattoptera) as a test case.; #BMC Evol. Biol. 9:50-50(2009). | |
| NP05192 | SDPEAPGIWFGPRL |
14 | Pseudoderopeltis foveolata | Pyrokinin | Pyrokinin-6 | 15626499#Predel R., Gaede G.; #Peptidomics of neurohemal organs from species of the cockroach family Blattidae: how do neuropeptides of closely related species differ?; #Peptides 26:3-9(2005). | |
| NP05193 | GGETSGEGKGMWFGPRL |
17 | Pycnoscelus surinamensis | Pyrokinin | Pyrokinin-5a | 19257902#Roth S., Fromm B., Gaede G., Predel R.; #A proteomic approach for studying insect phylogeny: CAPA peptides of ancient insect taxa (Dictyoptera, Blattoptera) as a test case.; #BMC Evol. Biol. 9:50-50(2009).$ #Predel R.; # #Submitted (SEP-2005) to UniProtKB. | |
| NP05194 | GGETGGEGKGMWFGPRL |
17 | Pycnoscelus surinamensis | Pyrokinin | Pyrokinin-5b | #Predel R.; ##Submitted (SEP-2005) to UniProtKB. | |
| NP05195 | SPPFAPRL |
8 | Rhodnius prolixus | Pyrokinin | Pyrokinin | 19137558#Ons S., Richter F., Urlaub H., Pomar R.R.; #The neuropeptidome of Rhodnius prolixus brain.; #Proteomics 9:788-792(2009). | |
| NP05196 | QTSFTPRL |
8 | Rhyparobia maderae | Pyrokinin | Leukopyrokinin | 3015140#Nachman R.J., Holman G.M., Cook B.J.; #Active fragments and analogs of the insect neuropeptide leucopyrokinin: structure-function studies.; #Biochem. Biophys. Res. Commun. 137:936-942(1986).$2877794#Holman G.M., Cook B.J., Nachman R.J.; #Primary structure and synthesis of a blocked myotropic neuropeptide isolated from the cockroach, Leucophaea maderae.; #Comp. Biochem. Physiol. 85C:219-224(1986). | |
| NP05197 | FGETSGETKGMWFGPRL |
17 | Rhyparobia maderae | Pyrokinin | Pyrokinin-5 | 19257902#Roth S., Fromm B., Gaede G., Predel R.; #A proteomic approach for studying insect phylogeny: CAPA peptides of ancient insect taxa (Dictyoptera, Blattoptera) as a test case.; #BMC Evol. Biol. 9:50-50(2009).$#Predel R.; ##Submitted (SEP-2005) to UniProtKB. | |
| NP05198 | AGPSATTGVWFGPRL |
15 | Sarcophaga bullata | Pyrokinin | Pyrokinin | 14706527#Predel R., Russell W.K., Tichy S.E., Russell D.H., Nachman R.J.; #Mass spectrometric analysis of putative capa-gene products in Musca domestica and Neobellieria bullata.; #Peptides 24:1487-1491(2003). | |
| NP05199 | DGAETPGAAASLWFGPRV |
18 | Schistocerca gregaria | Pyrokinin | Pyrokinin | 12504101#Clynen E., Huybrechts J., De Loof A., Schoofs L.; #Mass spectrometric analysis of the perisympathetic organs in locusts: identification of novel periviscerokinins.; #Biochem. Biophys. Res. Commun. 300:422-428(2003). | |
| NP05200 | DGYTPRL |
7 | Striatophasma naukluftense | Pyrokinin | Pyrokinin-1 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
| NP05201 | SPPFAPRL |
8 | Striatophasma naukluftense | Pyrokinin | Pyrokinin-2 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
| NP05202 | DPPFSPRL |
8 | Striatophasma naukluftense | Pyrokinin | Pyrokinin-3 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
| NP05203 | SGGGEGSGMWFGPRL |
15 | Striatophasma naukluftense | Pyrokinin | CAPA-Pyrokinin | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
| NP05204 | GGGSSGETNGMWFGPRL |
17 | Supella dimidiata | Pyrokinin | Pyrokinin-5 | 19257902#Roth S., Fromm B., Gaede G., Predel R.; #A proteomic approach for studying insect phylogeny: CAPA peptides of ancient insect taxa (Dictyoptera, Blattoptera) as a test case.; #BMC Evol. Biol. 9:50-50(2009). | |
| NP05205 | GGGSSGETNGMWFGPRL |
17 | Supella longipalpa | Pyrokinin | Pyrokinin-5 | 19257902#Roth S., Fromm B., Gaede G., Predel R.; #A proteomic approach for studying insect phylogeny: CAPA peptides of ancient insect taxa (Dictyoptera, Blattoptera) as a test case.; #BMC Evol. Biol. 9:50-50(2009). | |
| NP05206 | EGGSSGEASGMWFGPRL |
17 | Symploce pallens | Pyrokinin | Pyrokinin-5 | 19257902#Roth S., Fromm B., Gaede G., Predel R.; #A proteomic approach for studying insect phylogeny: CAPA peptides of ancient insect taxa (Dictyoptera, Blattoptera) as a test case.; #BMC Evol. Biol. 9:50-50(2009). | |
| NP05207 | SASGSGESSGMWFGPRL |
17 | Therea petiveriana | Pyrokinin | Pyrokinin-5 | 19257902#Roth S., Fromm B., Gaede G., Predel R.; #A proteomic approach for studying insect phylogeny: CAPA peptides of ancient insect taxa (Dictyoptera, Blattoptera) as a test case.; #BMC Evol. Biol. 9:50-50(2009). | |
| NP05208 | DGYTPRL |
7 | Tyrannophasma gladiator | Pyrokinin | Pyrokinin-1 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
| NP05209 | SPPFAPRL |
8 | Tyrannophasma gladiator | Pyrokinin | Pyrokinin-2 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
| NP05210 | DPPFAPRM |
8 | Tyrannophasma gladiator | Pyrokinin | Pyrokinin-3 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
| NP05211 | AELPQGLWVRPRL |
13 | Tyrannophasma gladiator | Pyrokinin | Pyrokinin-4 | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
| NP05212 | SGGGEGSGMWFGPRL |
15 | Tyrannophasma gladiator | Pyrokinin | CAPA-Pyrokinin | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
| NP05213 | TSSLFPHPRL |
10 | Schistocerca gregaria | Pyrokinin | Schistomyotropin-2 | 11121115#Torfs P, Nieto J, Cerstiaens A, Boon D, Baggerman G, Poulos C, Waelkens E, Derua R, Calderón J, De Loof A, Schoofs L#Pyrokinin neuropeptides in a crustacean#Isolation and identification in the white shrimp Penaeus vannamei Eur J Biochem 2001 Jan;268(1):149-54 $12504101#Clynen E., Huybrechts J., De Loof A., Schoofs L.#Mass spectrometric analysis of the perisympathetic organs in locusts: identification of novel periviscerokinins.#Biochem. Biophys. Res. Commun. 300:422-428(2003). |