| NPID | NP05011 |
| Name | Pheromone biosynthesis-activating neuropeptide |
| Organism | Agrotis ipsilon |
| NCBI Taxa ID | 56364 |
| Tissue Specificity | Expressed in the mandibular, maxillary and labial neuromeres of the male and female brain-subesophageal ganglions, in the corpora cardiaca and all around the corpora allata, and at a lower level in the brain near the calyx and pedunculus of the mushroom body. Expressed in larvae and adult of both sexes. |
| Family | Pyrokinin |
| UniProt ID | PBAN_AGRIP |
| Length | 33 |
| Modification | |
| Gene Ontology | |
| Sequence | LADDTPATPADQEMYRPDPEQIDSRTKYFSPRL |
| Properties | View |
| Structure | NA |
| Reference |