Total number of results for Allatostatin are 361
Download
as Fasta All
NPID | Sequence | Length | Organism | Family | Name | PMID | Peptide_REF |
---|---|---|---|---|---|---|---|
NP00236 |
SRPYSFGL
|
8 | Aedes aegypti | Allatostatin | Allatostatin | 9357049#Veenstra JA, Noriega FG, Graf R, Feyereisen R#Identification of three allatostatins and their cDNA from the mosquito Aedes aegypti#Peptides 1997;18(7):937-42 | |
NP00237 |
GEGKMFWRCYFNAVSCF
|
17 | Amblyomma variegatum | Allatostatin | Allatostatin CC peptide | 20888826#Christie AE, Nolan DH, Ohno P, Hartline N, Lenz PH#Identification of chelicerate neuropeptides using bioinformatics of publicly accessible expressed sequence tags#Gen Comp Endocrinol 2011 Jan 1;170(1):144-55 | |
NP00238 |
GDGRLYAFGL
|
10 | Ascaris suum | Allatostatin | Allatostatin A | 16185693#Mousley A, Moffett CL, Duve H, Thorpe A, Halton DW, Geary TG, Thompson DP, Maule AG, Marks NJ#Expression and bioactivity of allatostatin-like neuropeptides in helminths#Int J Parasitol 2005 Dec;35(14):1557-67 | |
NP00239 |
LYDFGL
|
6 | Blattella germanica | Allatostatin | Allatostatin-1 | 7846299#Bellés X, Maestro JL, Piulachs MD, Johnsen AH, Duve H, Thorpe A#Allatostatic neuropeptides from the cockroach Blattella germanica (L#) (Dictyoptera, Blattellidae) Identification, immunolocalization and activity Regul Pept 1994 Oct 21;53(3):237-47 | |
NP00240 |
DRLYSFGL
|
8 | Blattella germanica | Allatostatin | BLAST-2 | 9474781#Piulachs MD, Vilaplana L, Bartolomé JM, Carreño C, Martín D, González-Muñiz R, Herranz R, García-López MT, Andreu D, Bellés X#Ketomethylene and methyleneamino pseudopeptide analogues of insect allatostatins inhibit juvenile hormone and vitellogenin production in the cockroach Blattella germanica#Insect Biochem Mol Biol 1997 Oct;27(10):851-8 | |
NP00241 |
AGSDGRLYSFGL
|
12 | Blattella germanica | Allatostatin | BLAST-3 | 7846299#Bellés X, Maestro JL, Piulachs MD, Johnsen AH, Duve H, Thorpe A#Allatostatic neuropeptides from the cockroach Blattella germanica (L) (Dictyoptera, Blattellidae) Identification, immunolocalization and activity #Regul Pept 1994 Oct 21;53(3):237-47 | |
NP00242 |
APSSAQRLYGFGL
|
13 | Blattella germanica | Allatostatin | BLAST-4 | 7846299#Bellés X, Maestro JL, Piulachs MD, Johnsen AH, Duve H, Thorpe A#Allatostatic neuropeptides from the cockroach Blattella germanica (L#) (Dictyoptera, Blattellidae) Identification, immunolocalization and activity Regul Pept 1994 Oct 21;53(3):237-47 | |
NP00243 |
APYGFGI
|
7 | Calanus finmarchicus | Allatostatin | Allatostatin A | 17950732#Christie AE, Sousa GL, Rus S, Smith CM, Towle DW, Hartline DK, Dickinson PS#Identification of A-type allatostatins possessing -YXFGI/Vamide carboxy-termini from the nervous system of the copepod crustacean Calanus finmarchicus#Gen Comp Endocrinol 2008 Feb 1;155(3):526-33 | |
NP00244 |
EPYGFGI
|
7 | Calanus finmarchicus | Allatostatin | Allatostatin A | 17950732#Christie AE, Sousa GL, Rus S, Smith CM, Towle DW, Hartline DK, Dickinson PS#Identification of A-type allatostatins possessing -YXFGI/Vamide carboxy-termini from the nervous system of the copepod crustacean Calanus finmarchicus#Gen Comp Endocrinol 2008 Feb 1;155(3):526-33 | |
NP00245 |
GPXYDFGM
|
8 | Calliphora vomitoria | Allatostatin | [HYP3]Met-callatostatin | 8063725#Duve H, Johnsen AH, Scott AG, East P, Thorpe A#[Hyp3]Met-callatostatin#Identification and biological properties of a novel neuropeptide from the blowfly Calliphora vomitoria J Biol Chem 1994 Aug 19;269(33):21059-66 | |
NP00246 |
XRPYSFGL
|
8 | Calliphora vomitoria | Allatostatin | Callatostatin 4 | 8460157#Duve H, Johnsen AH, Scott AG, Yu CG, Yagi KJ, Tobe SS, Thorpe A#Callatostatins: neuropeptides from the blowfly Calliphora vomitoria with sequence homology to cockroach allatostatins#Proc Natl Acad Sci U S A 1993 Mar 15;90(6):2456-60 | |
NP00247 |
LPVYNFGL
|
8 | Calliphora vomitoria | Allatostatin | Leu-callatostatin | 8952000#Duve H, Johnsen AH, Maestro JL, Scott AG, East PD, Thorpe A#Identification of the dipteran Leu-callatostatin peptide family: the pattern of precursor processing revealed by isolation studies in Calliphora vomitoria#Regul Pept 1996 Nov 14;67(1):11-9 | |
NP00248 |
NRPYSFGL
|
8 | Calliphora vomitoria | Allatostatin | Leu-callatostatin | 8952000#Duve H, Johnsen AH, Maestro JL, Scott AG, East PD, Thorpe A#Identification of the dipteran Leu-callatostatin peptide family: the pattern of precursor processing revealed by isolation studies in Calliphora vomitoria#Regul Pept 1996 Nov 14;67(1):11-9 | |
NP00249 |
PYDFGM
|
6 | Calliphora vomitoria | Allatostatin | Met-callatostatin | 7480873#Duve H, Johnsen AH, Scott AG, Thorpe A#Isolation, identification and functional significance of [Hyp2]Met-callatostatin and des Gly-Pro Met-callatostatin, two further post-translational modifications of the blowfly neuropeptide Met-callatostatin#Regul Pept 1995 Jun 27;57(3):237-45 | |
NP00250 |
QIRYHQCYFNPISCF
|
15 | Cancer borealis | Allatostatin | Allatostatin C | 19505516#Ma M, Szabo TM, Jia C, Marder E, Li L#Mass spectrometric characterization and physiological actions of novel crustacean C-type allatostatins#Peptides 2009 Sep;30(9):1660-8 | |
NP00251 |
SYWKQCAFNAVSCF
|
14 | Cancer borealis | Allatostatin | Allatostatin C | 19505516#Ma M, Szabo TM, Jia C, Marder E, Li L#Mass spectrometric characterization and physiological actions of novel crustacean C-type allatostatins#Peptides 2009 Sep;30(9):1660-8 | |
NP00252 |
LPVYNFGL
|
8 | Cydia pomonella | Allatostatin | Leu-callatostatin | 9182602#Duve H, Johnsen AH, Maestro JL, Scott AG, Crook N, Winstanley D, Thorpe A#Identification, tissue localisation and physiological effect in vitro of a neuroendocrine peptide identical to a dipteran Leu-callatostatin in the codling moth Cydia pomonella (Tortricidae: Lepidoptera)#Cell Tissue Res 1997 Jul;289(1):73-83 | |
NP00253 |
EVRYRQCYFNPISCF
|
15 | Drosophila melanogaster | Allatostatin | Allatostatin C | 12479379#Kaminski S, Orlowski E, Berry K, Nichols R#The effects of three Drosophila melanogaster myotropins on the frequency of foregut contractions differ#J Neurogenet 2002 Apr-Jun;16(2):125-34 | |
NP00254 |
GEGKMFWRCYFNAVSCF
|
17 | Mesobuthus gibbosus | Allatostatin | Allatostatin CC peptide | 20888826#Christie AE, Nolan DH, Ohno P, Hartline N, Lenz PH#Identification of chelicerate neuropeptides using bioinformatics of publicly accessible expressed sequence tags#Gen Comp Endocrinol 2011 Jan 1;170(1):144-55 | |
NP00255 |
PRVYGFGL
|
8 | Orconectes limosus | Allatostatin | Allatostatin A | 10477125#Dircksen H, Skiebe P, Abel B, Agricola H, Buchner K, Muren JE, Nässel DR#Structure, distribution, and biological activity of novel members of the allatostatin family in the crayfish Orconectes limosus#Peptides 1999;20(6):695-712 | |
NP00256 |
AGPYAFGL
|
8 | Orconectes limosus | Allatostatin | Carcinustatin-8 | 10477125#Dircksen H, Skiebe P, Abel B, Agricola H, Buchner K, Muren JE, Nässel DR#Structure, distribution, and biological activity of novel members of the allatostatin family in the crayfish Orconectes limosus#Peptides 1999;20(6):695-712 | |
NP00257 |
SAGPYAFGL
|
9 | Orconectes limosus | Allatostatin | orcostatin I | 10477125#Dircksen H, Skiebe P, Abel B, Agricola H, Buchner K, Muren JE, Nässel DR#Structure, distribution, and biological activity of novel members of the allatostatin family in the crayfish Orconectes limosus#Peptides 1999;20(6):695-712 | |
NP00258 |
ANQYTFGL
|
8 | Penaeus monodon | Allatostatin | Allatostatin | 12126730#Duve H, Johnsen AH, Scott AG, Thorpe A#Allatostatins of the tiger prawn, Penaeus monodon (Crustacea: Penaeidea)#Peptides 2002 Jun;23(6):1039-51 | |
NP00259 |
ASQYTFGL
|
8 | Penaeus monodon | Allatostatin | Allatostatin | 12126730#Duve H, Johnsen AH, Scott AG, Thorpe A#Allatostatins of the tiger prawn, Penaeus monodon (Crustacea: Penaeidea)#Peptides 2002 Jun;23(6):1039-51 | |
NP00260 |
ATGAASLYSFGL
|
12 | Schistocerca gregaria | Allatostatin | Allatostatin 3 | 8902848#Veelaert D, Devreese B, Schoofs L, Van Beeumen J, Vanden Broeck J, Tobe SS, De Loof A#Isolation and characterization of eight myoinhibiting peptides from the desert locust, Schistocerca gregaria: new members of the cockroach allatostatin family#Mol Cell Endocrinol 1996 Sep 18;122(2):183-90 | |
NP00261 |
AYTYVSEYKRLPVYNFGL
|
18 | Schistocerca gregaria | Allatostatin | Allatostatin-2 | 8902848#Veelaert D, Devreese B, Schoofs L, Van Beeumen J, Vanden Broeck J, Tobe SS, De Loof A#Isolation and characterization of eight myoinhibiting peptides from the desert locust, Schistocerca gregaria: new members of the cockroach allatostatin family#Mol Cell Endocrinol 1996 Sep 18;122(2):183-90 | |
NP00262 |
ARPYSFGL
|
8 | Schistocerca gregaria | Allatostatin | Allatostatin-6 | 8902848#Veelaert D, Devreese B, Schoofs L, Van Beeumen J, Vanden Broeck J, Tobe SS, De Loof A#Isolation and characterization of eight myoinhibiting peptides from the desert locust, Schistocerca gregaria: new members of the cockroach allatostatin family#Mol Cell Endocrinol 1996 Sep 18;122(2):183-90 | |
NP00263 |
APAEHRFSFGL
|
11 | Schistocerca gregaria | Allatostatin | Scg-AST-10 | 8902848#Veelaert D, Devreese B, Schoofs L, Van Beeumen J, Vanden Broeck J, Tobe SS, De Loof A#Isolation and characterization of eight myoinhibiting peptides from the desert locust, Schistocerca gregaria: new members of the cockroach allatostatin family#Mol Cell Endocrinol 1996 Sep 18;122(2):183-90 | |
NP00264 |
GPRTYSFGL
|
9 | Schistocerca gregaria | Allatostatin | Scg-AST-4 | 8902848#Veelaert D, Devreese B, Schoofs L, Van Beeumen J, Vanden Broeck J, Tobe SS, De Loof A#Isolation and characterization of eight myoinhibiting peptides from the desert locust, Schistocerca gregaria: new members of the cockroach allatostatin family#Mol Cell Endocrinol 1996 Sep 18;122(2):183-90 | |
NP00265 |
GRLYSFGL
|
8 | Schistocerca gregaria | Allatostatin | Scg-AST-5 | 8902848#Veelaert D, Devreese B, Schoofs L, Van Beeumen J, Vanden Broeck J, Tobe SS, De Loof A#Isolation and characterization of eight myoinhibiting peptides from the desert locust, Schistocerca gregaria: new members of the cockroach allatostatin family#Mol Cell Endocrinol 1996 Sep 18;122(2):183-90 | |
NP00266 |
AGPAPSRLYSFGL
|
13 | Schistocerca gregaria | Allatostatin | Scg-AST-7 | 8902848#Veelaert D, Devreese B, Schoofs L, Van Beeumen J, Vanden Broeck J, Tobe SS, De Loof A#Isolation and characterization of eight myoinhibiting peptides from the desert locust, Schistocerca gregaria: new members of the cockroach allatostatin family#Mol Cell Endocrinol 1996 Sep 18;122(2):183-90 | |
NP00267 |
EGRMYSFGL
|
9 | Schistocerca gregaria | Allatostatin | Scg-AST-8 | 8902848#Veelaert D, Devreese B, Schoofs L, Van Beeumen J, Vanden Broeck J, Tobe SS, De Loof A#Isolation and characterization of eight myoinhibiting peptides from the desert locust, Schistocerca gregaria: new members of the cockroach allatostatin family#Mol Cell Endocrinol 1996 Sep 18;122(2):183-90 | |
NP00268 |
ESRYRQCYFNPISCF
|
15 | Tenebrio molitor | Allatostatin | Allatostatin-C | 18201799#Weaver RJ, Audsley N#Neuropeptides of the beetle, Tenebrio molitor identified using MALDI-TOF mass spectrometry and deduced sequences from the Tribolium castaneum genome#Peptides 2008 Feb;29(2):168-78 | |
NP00269 |
QIRYHQCYFNPISCF
|
15 | Tetranychus urticae | Allatostatin | Allatostatin C | 20888826#Christie AE, Nolan DH, Ohno P, Hartline N, Lenz PH#Identification of chelicerate neuropeptides using bioinformatics of publicly accessible expressed sequence tags#Gen Comp Endocrinol 2011 Jan 1;170(1):144-55 | |
NP00270 |
SPKYNFGL
|
8 | Aedes aegypti | Allatostatin | Allatostatin 1 | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
NP00271 |
LPHYNFGL
|
8 | Aedes aegypti | Allatostatin | Allatostatin 2 | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
NP00272 |
ASAYRYHFGL
|
10 | Aedes aegypti | Allatostatin | Allatostatin 3 | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
NP00273 |
QIRYRQCYFNPISCF
|
15 | Aedes aegypti | Allatostatin | Allatostatin C | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
NP00274 |
RVYDFGL
|
7 | Aedes aegypti | Allatostatin | Allatostatin-4 | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
NP00275 |
LPNRYNFGL
|
9 | Aedes aegypti | Allatostatin | Allatostatin-5 | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
NP00276 |
VYEDKRLPNRYNFGL
|
15 | Aedes aegypti | Allatostatin | AST-5 | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
NP00277 |
TWKNLQGGW
|
9 | Aedes aegypti | Allatostatin | MIP-1 | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
NP00278 |
AWNKINGGW
|
9 | Aedes aegypti | Allatostatin | MIP-2 | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
NP00279 |
VNAGPAQWNKFRGSW
|
15 | Aedes aegypti | Allatostatin | MIP-3 | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
NP00280 |
EPGWNNLKGLW
|
11 | Aedes aegypti | Allatostatin | MIP-4b | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
NP00281 |
SEKWNKLSSSW
|
11 | Aedes aegypti | Allatostatin | MIP-5 | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
NP00282 |
AYTYVSEYKRLPVYNFGI
|
18 | Apis mellifera | Allatostatin | Allatostatin A | 19576913#Boerjan B, Cardoen D, Bogaerts A, Landuyt B, Schoofs L, Verleyen P#Mass spectrometric profiling of (neuro)-peptides in the worker honeybee, Apis mellifera#Neuropharmacology 2010 Jan;58(1):248-58 | |
NP00283 |
AAGLQNYDFG
|
10 | Callinectes sapidus | Allatostatin | Allatostatin A | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
NP00284 |
AGLSALYSFG
|
10 | Callinectes sapidus | Allatostatin | Allatostatin A | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
NP00285 |
AGPYSFGL
|
8 | Callinectes sapidus | Allatostatin | Allatostatin A | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
NP00286 |
ALTTLYAFGL
|
10 | Callinectes sapidus | Allatostatin | Allatostatin A | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
NP00287 |
APQPYAFGL
|
9 | Callinectes sapidus | Allatostatin | Allatostatin A | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
NP00288 |
APRPYSFGL
|
9 | Callinectes sapidus | Allatostatin | Allatostatin A | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
NP00289 |
ARAYDFGL
|
8 | Callinectes sapidus | Allatostatin | Allatostatin A | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
NP00290 |
ARGYDFGL
|
8 | Callinectes sapidus | Allatostatin | Allatostatin A | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
NP00291 |
ARPYSFGL
|
8 | Callinectes sapidus | Allatostatin | Allatostatin A | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
NP00292 |
ASPYAFGL
|
8 | Callinectes sapidus | Allatostatin | Allatostatin A | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
NP00293 |
DGPYSFGL
|
8 | Callinectes sapidus | Allatostatin | Allatostatin A | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
NP00294 |
DPYAFGL
|
7 | Callinectes sapidus | Allatostatin | Allatostatin A | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
NP00295 |
ERAYSFGL
|
8 | Callinectes sapidus | Allatostatin | Allatostatin A | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
NP00296 |
FSGTYNFGL
|
9 | Callinectes sapidus | Allatostatin | Allatostatin A | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
NP00297 |
GPPYSFGL
|
8 | Callinectes sapidus | Allatostatin | Allatostatin A | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
NP00298 |
GPYSFGL
|
7 | Callinectes sapidus | Allatostatin | Allatostatin A | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
NP00299 |
GSGQYAYGLGKAGQYSFGL
|
19 | Callinectes sapidus | Allatostatin | Allatostatin A | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
NP00300 |
NGSYPFGL
|
8 | Callinectes sapidus | Allatostatin | Allatostatin A | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
NP00301 |
NPYSFGL
|
7 | Callinectes sapidus | Allatostatin | Allatostatin A | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
NP00302 |
NVYSFGL
|
7 | Callinectes sapidus | Allatostatin | Allatostatin A | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
NP00303 |
PRVYSFGL
|
8 | Callinectes sapidus | Allatostatin | Allatostatin A | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
NP00304 |
QWLYSMFGL
|
9 | Callinectes sapidus | Allatostatin | Allatostatin A | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
NP00305 |
RNMYSFGL
|
8 | Callinectes sapidus | Allatostatin | Allatostatin A | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
NP00306 |
SDMYSFGL
|
8 | Callinectes sapidus | Allatostatin | Allatostatin A | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
NP00307 |
SGHYNFGL
|
8 | Callinectes sapidus | Allatostatin | Allatostatin A | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
NP00308 |
SGNYNFGL
|
8 | Callinectes sapidus | Allatostatin | Allatostatin A | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
NP00309 |
SNPYSFGL
|
8 | Callinectes sapidus | Allatostatin | Allatostatin A | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
NP00310 |
SSGQYAFGL
|
9 | Callinectes sapidus | Allatostatin | Allatostatin A | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
NP00311 |
TAPYAFGL
|
8 | Callinectes sapidus | Allatostatin | Allatostatin A | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
NP00312 |
THPTYSFGL
|
9 | Callinectes sapidus | Allatostatin | Allatostatin A | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
NP00313 |
TPQANSFGL
|
9 | Callinectes sapidus | Allatostatin | Allatostatin A | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
NP00314 |
TRPYSFGL
|
8 | Callinectes sapidus | Allatostatin | Allatostatin A | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
NP00315 |
YAFGL
|
5 | Callinectes sapidus | Allatostatin | Allatostatin A | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
NP00316 |
AGWNKFQGSW
|
10 | Callinectes sapidus | Allatostatin | Allatostatin B | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
NP00317 |
AGWSSLKGAW
|
10 | Callinectes sapidus | Allatostatin | Allatostatin B | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
NP00318 |
AGWSSMRGAW
|
10 | Callinectes sapidus | Allatostatin | Allatostatin B | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
NP00319 |
AWSNLQGAW
|
9 | Callinectes sapidus | Allatostatin | Allatostatin B | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
NP00320 |
GNWNKFQGSW
|
10 | Callinectes sapidus | Allatostatin | Allatostatin B | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
NP00321 |
NDWSKFGQSW
|
10 | Callinectes sapidus | Allatostatin | Allatostatin B | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
NP00322 |
NNNWSKFQGSW
|
11 | Callinectes sapidus | Allatostatin | Allatostatin B | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
NP00323 |
NNNWTKFQGSW
|
11 | Callinectes sapidus | Allatostatin | Allatostatin B | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
NP00324 |
NNWSKFQGSW
|
10 | Callinectes sapidus | Allatostatin | Allatostatin B | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
NP00325 |
NWNKFQGSW
|
9 | Callinectes sapidus | Allatostatin | Allatostatin B | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
NP00326 |
SGDWSSLRGAW
|
11 | Callinectes sapidus | Allatostatin | Allatostatin B | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
NP00327 |
SGKWSNLRGAW
|
11 | Callinectes sapidus | Allatostatin | Allatostatin B | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
NP00328 |
STDWSSLRSAW
|
11 | Callinectes sapidus | Allatostatin | Allatostatin B | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
NP00329 |
STNWSSLRSAW
|
11 | Callinectes sapidus | Allatostatin | Allatostatin B | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
NP00330 |
TGWNKFQGSW
|
10 | Callinectes sapidus | Allatostatin | Allatostatin B | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
NP00331 |
TSWGKFQGSW
|
10 | Callinectes sapidus | Allatostatin | Allatostatin B | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
NP00332 |
VPNDWAHFRGSW
|
12 | Callinectes sapidus | Allatostatin | Allatostatin B | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
NP00333 |
DPYAFGL
|
7 | Cancer borealis | Allatostatin | Allatostatin A | 18700782#Behrens HL, Chen R, Li L#Combining microdialysis, NanoLC-MS, and MALDI-TOF/TOF to detect neuropeptides secreted in the crab, Cancer borealis#Anal Chem 2008 Sep 15;80(18):6949-58 | |
NP00334 |
ERAYSFGL
|
8 | Cancer borealis | Allatostatin | Allatostatin A | 17381149#DeKeyser SS, Kutz-Naber KK, Schmidt JJ, Barrett-Wilt GA, Li L#Imaging mass spectrometry of neuropeptides in decapod crustacean neuronal tissues#J Proteome Res 2007 May;6(5):1782-91 | |
NP00335 |
ERPYSFGL
|
8 | Cancer borealis | Allatostatin | Allatostatin A | 18700782#Behrens HL, Chen R, Li L#Combining microdialysis, NanoLC-MS, and MALDI-TOF/TOF to detect neuropeptides secreted in the crab, Cancer borealis#Anal Chem 2008 Sep 15;80(18):6949-58 | |
NP00336 |
ERPYSGL
|
7 | Cancer borealis | Allatostatin | Allatostatin A | 19185513#Chen R, Ma M, Hui L, Zhang J, Li L#Measurement of neuropeptides in crustacean hemolymph via MALDI mass spectrometry#J Am Soc Mass Spectrom 2009 Apr;20(4):708-18 | |
NP00337 |
PDMYAFGL
|
8 | Cancer borealis | Allatostatin | Allatostatin A | 18700782#Behrens HL, Chen R, Li L#Combining microdialysis, NanoLC-MS, and MALDI-TOF/TOF to detect neuropeptides secreted in the crab, Cancer borealis#Anal Chem 2008 Sep 15;80(18):6949-58 | |
NP00338 |
PRDYAFGL
|
8 | Cancer borealis | Allatostatin | Allatostatin A | 17381149#DeKeyser SS, Kutz-Naber KK, Schmidt JJ, Barrett-Wilt GA, Li L#Imaging mass spectrometry of neuropeptides in decapod crustacean neuronal tissues#J Proteome Res 2007 May;6(5):1782-91 | |
NP00339 |
SPYAFGL
|
7 | Cancer borealis | Allatostatin | Allatostatin A | 18700782#Behrens HL, Chen R, Li L#Combining microdialysis, NanoLC-MS, and MALDI-TOF/TOF to detect neuropeptides secreted in the crab, Cancer borealis#Anal Chem 2008 Sep 15;80(18):6949-58 | |
NP00340 |
YAFGL
|
5 | Cancer borealis | Allatostatin | Allatostatin A | 18700782#Behrens HL, Chen R, Li L#Combining microdialysis, NanoLC-MS, and MALDI-TOF/TOF to detect neuropeptides secreted in the crab, Cancer borealis#Anal Chem 2008 Sep 15;80(18):6949-58 | |
NP00341 |
YSFGL
|
5 | Cancer borealis | Allatostatin | Allatostatin A | 18700782#Behrens HL, Chen R, Li L#Combining microdialysis, NanoLC-MS, and MALDI-TOF/TOF to detect neuropeptides secreted in the crab, Cancer borealis#Anal Chem 2008 Sep 15;80(18):6949-58 | |
NP00342 |
GNWNKFQGSW
|
10 | Cancer borealis | Allatostatin | Allatostatin B | 17381149#DeKeyser SS, Kutz-Naber KK, Schmidt JJ, Barrett-Wilt GA, Li L#Imaging mass spectrometry of neuropeptides in decapod crustacean neuronal tissues#J Proteome Res 2007 May;6(5):1782-91 | |
NP00343 |
NNNWSKFQGSW
|
11 | Cancer borealis | Allatostatin | Allatostatin B | 18700782#Behrens HL, Chen R, Li L#Combining microdialysis, NanoLC-MS, and MALDI-TOF/TOF to detect neuropeptides secreted in the crab, Cancer borealis#Anal Chem 2008 Sep 15;80(18):6949-58 | |
NP00344 |
NNWSKFQGSW
|
10 | Cancer borealis | Allatostatin | Allatostatin B | 17381149#DeKeyser SS, Kutz-Naber KK, Schmidt JJ, Barrett-Wilt GA, Li L#Imaging mass spectrometry of neuropeptides in decapod crustacean neuronal tissues#J Proteome Res 2007 May;6(5):1782-91 | |
NP00345 |
NWNKFQGSW
|
9 | Cancer borealis | Allatostatin | Allatostatin B | 18700782#Behrens HL, Chen R, Li L#Combining microdialysis, NanoLC-MS, and MALDI-TOF/TOF to detect neuropeptides secreted in the crab, Cancer borealis#Anal Chem 2008 Sep 15;80(18):6949-58 | |
NP00346 |
STNWSSLRSAW
|
11 | Cancer borealis | Allatostatin | Allatostatin B | 17381149#DeKeyser SS, Kutz-Naber KK, Schmidt JJ, Barrett-Wilt GA, Li L#Imaging mass spectrometry of neuropeptides in decapod crustacean neuronal tissues#J Proteome Res 2007 May;6(5):1782-91 | |
NP00347 |
TSWFKFQGSW
|
10 | Cancer borealis | Allatostatin | Allatostatin B | 18700782#Behrens HL, Chen R, Li L#Combining microdialysis, NanoLC-MS, and MALDI-TOF/TOF to detect neuropeptides secreted in the crab, Cancer borealis#Anal Chem 2008 Sep 15;80(18):6949-58 | |
NP00348 |
VPNDWAHFRGSW
|
12 | Cancer borealis | Allatostatin | Allatostatin B | 17381149#DeKeyser SS, Kutz-Naber KK, Schmidt JJ, Barrett-Wilt GA, Li L#Imaging mass spectrometry of neuropeptides in decapod crustacean neuronal tissues#J Proteome Res 2007 May;6(5):1782-91 | |
NP00349 |
GGSLYSFGL
|
9 | Cancer borealis | Allatostatin | Allatostatin-3 | 14535947#Li L, Kelley WP, Billimoria CP, Christie AE, Pulver SR, Sweedler JV, Marder E#Mass spectrometric investigation of the neuropeptide complement and release in the pericardial organs of the crab, Cancer borealis#J Neurochem 2003 Nov;87(3):642-56 | |
NP00350 |
AWQDLQGGW
|
9 | Carausius morosus | Allatostatin | Cam-AST-B1 | 16061202#Husson SJ, Clynen E, Baggerman G, De Loof A, Schoofs L#Discovering neuropeptides in Caenorhabditis elegans by two dimensional liquid chromatography and mass spectrometry#Biochem Biophys Res Commun 2005 Sep 16;335(1):76-86 | |
NP00351 |
AWQDLNTGW
|
9 | Carausius morosus | Allatostatin | Cam-AST-B2 | 16061202#Husson SJ, Clynen E, Baggerman G, De Loof A, Schoofs L#Discovering neuropeptides in Caenorhabditis elegans by two dimensional liquid chromatography and mass spectrometry#Biochem Biophys Res Commun 2005 Sep 16;335(1):76-86 | |
NP00352 |
GWQDLQSGW
|
9 | Carausius morosus | Allatostatin | Cam-AST-B3 | 16061202#Husson SJ, Clynen E, Baggerman G, De Loof A, Schoofs L#Discovering neuropeptides in Caenorhabditis elegans by two dimensional liquid chromatography and mass spectrometry#Biochem Biophys Res Commun 2005 Sep 16;335(1):76-86 | |
NP00353 |
AWQDLQGAW
|
9 | Carausius morosus | Allatostatin | Cam-AST-B4 | 16061202#Husson SJ, Clynen E, Baggerman G, De Loof A, Schoofs L#Discovering neuropeptides in Caenorhabditis elegans by two dimensional liquid chromatography and mass spectrometry#Biochem Biophys Res Commun 2005 Sep 16;335(1):76-86 | |
NP00354 |
AWQDLQAGW
|
9 | Carausius morosus | Allatostatin | Cam-AST-B5 | 16061202#Husson SJ, Clynen E, Baggerman G, De Loof A, Schoofs L#Discovering neuropeptides in Caenorhabditis elegans by two dimensional liquid chromatography and mass spectrometry#Biochem Biophys Res Commun 2005 Sep 16;335(1):76-86 | |
NP00355 |
AWQDLGSAW
|
9 | Carausius morosus | Allatostatin | Cam-AST-B6 | 16061202#Husson SJ, Clynen E, Baggerman G, De Loof A, Schoofs L#Discovering neuropeptides in Caenorhabditis elegans by two dimensional liquid chromatography and mass spectrometry#Biochem Biophys Res Commun 2005 Sep 16;335(1):76-86 | |
NP00356 |
AAPYAFGL
|
8 | Carcinus maenas | Allatostatin | Allatostatin A | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
NP00357 |
AASPYSFGL
|
9 | Carcinus maenas | Allatostatin | Allatostatin A | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
NP00358 |
APGPYAFGL
|
9 | Carcinus maenas | Allatostatin | Allatostatin A | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
NP00359 |
ARPYAFGL
|
8 | Carcinus maenas | Allatostatin | Allatostatin A | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
NP00360 |
ARPYSFGL
|
8 | Carcinus maenas | Allatostatin | Allatostatin A | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
NP00361 |
EPYEFGL
|
7 | Carcinus maenas | Allatostatin | Allatostatin A | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
NP00362 |
FSGASPYGL
|
9 | Carcinus maenas | Allatostatin | Allatostatin A | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
NP00363 |
GKPYAFGL
|
8 | Carcinus maenas | Allatostatin | Allatostatin A | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
NP00364 |
KLPYSFGL
|
8 | Carcinus maenas | Allatostatin | Allatostatin A | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
NP00365 |
LKAYDFGL
|
8 | Carcinus maenas | Allatostatin | Allatostatin A | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
NP00366 |
PADLYEFGL
|
9 | Carcinus maenas | Allatostatin | Allatostatin A | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
NP00367 |
RGPYAFGL
|
8 | Carcinus maenas | Allatostatin | Allatostatin A | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
NP00368 |
TRPYSFGL
|
8 | Carcinus maenas | Allatostatin | Allatostatin A | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
NP00369 |
AGWNKFQGSW
|
10 | Carcinus maenas | Allatostatin | Allatostatin B | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
NP00370 |
AWSNLGQAW
|
9 | Carcinus maenas | Allatostatin | Allatostatin B | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
NP00371 |
GSNWSNLRGAW
|
11 | Carcinus maenas | Allatostatin | Allatostatin B | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
NP00372 |
GVNWSNLRGAW
|
11 | Carcinus maenas | Allatostatin | Allatostatin B | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
NP00373 |
NNNWSKFQGSW
|
11 | Carcinus maenas | Allatostatin | Allatostatin B | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
NP00374 |
NNWSKFQGSW
|
10 | Carcinus maenas | Allatostatin | Allatostatin B | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
NP00375 |
QWSSMRGAW
|
9 | Carcinus maenas | Allatostatin | Allatostatin B | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
NP00376 |
SGKWSNLRGAW
|
11 | Carcinus maenas | Allatostatin | Allatostatin B | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
NP00377 |
STNWSSLRSAW
|
11 | Carcinus maenas | Allatostatin | Allatostatin B | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
NP00378 |
TSWGKFQGSW
|
10 | Carcinus maenas | Allatostatin | Allatostatin B | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
NP00379 |
VPNDWAHFRGSW
|
12 | Carcinus maenas | Allatostatin | Allatostatin B | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
NP00380 |
VTWGKFQGSW
|
10 | Carcinus maenas | Allatostatin | Allatostatin B | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
NP00381 |
GGPYSXGL
|
8 | Carcinus maenas | Allatostatin | Carcinustatin-16 | 9461295#Duve H, Johnsen AH, Maestro JL, Scott AG, Jaros PP, Thorpe A#Isolation and identification of multiple neuropeptides of the allatostatin superfamily in the shore crab Carcinus maenas#Eur J Biochem 1997 Dec 15;250(3):727-34 | |
NP00382 |
SFGGNPTGDPNLNIYSFGL
|
19 | Daphnia pulex | Allatostatin | Allatostatin A1 | 21830762#Dircksen H, Neupert S, Predel R, Verleyen P, Huybrechts J, Strauss J, Hauser F, Stafflinger E, Schneider M, Pauwels K, Schoofs L, Grimmelikhuijzen CJ#Genomics, transcriptomics, and peptidomics of Daphnia pulex neuropeptides and protein hormones#J Proteome Res 2011 Oct 7;10(10):4478-504 | |
NP00383 |
TSRSYSINPYSFGL
|
14 | Daphnia pulex | Allatostatin | Allatostatin A2 | 21830762#Dircksen H, Neupert S, Predel R, Verleyen P, Huybrechts J, Strauss J, Hauser F, Stafflinger E, Schneider M, Pauwels K, Schoofs L, Grimmelikhuijzen CJ#Genomics, transcriptomics, and peptidomics of Daphnia pulex neuropeptides and protein hormones#J Proteome Res 2011 Oct 7;10(10):4478-504 | |
NP00384 |
GGNAKSYPQQIPYSFGL
|
17 | Daphnia pulex | Allatostatin | Allatostatin A3 | 21830762#Dircksen H, Neupert S, Predel R, Verleyen P, Huybrechts J, Strauss J, Hauser F, Stafflinger E, Schneider M, Pauwels K, Schoofs L, Grimmelikhuijzen CJ#Genomics, transcriptomics, and peptidomics of Daphnia pulex neuropeptides and protein hormones#J Proteome Res 2011 Oct 7;10(10):4478-504 | |
NP00385 |
NPTKYNFGL
|
9 | Daphnia pulex | Allatostatin | Allatostatin A4 | 21830762#Dircksen H, Neupert S, Predel R, Verleyen P, Huybrechts J, Strauss J, Hauser F, Stafflinger E, Schneider M, Pauwels K, Schoofs L, Grimmelikhuijzen CJ#Genomics, transcriptomics, and peptidomics of Daphnia pulex neuropeptides and protein hormones#J Proteome Res 2011 Oct 7;10(10):4478-504 | |
NP00386 |
PDRFGFGL
|
8 | Daphnia pulex | Allatostatin | Allatostatin A5 | 21830762#Dircksen H, Neupert S, Predel R, Verleyen P, Huybrechts J, Strauss J, Hauser F, Stafflinger E, Schneider M, Pauwels K, Schoofs L, Grimmelikhuijzen CJ#Genomics, transcriptomics, and peptidomics of Daphnia pulex neuropeptides and protein hormones#J Proteome Res 2011 Oct 7;10(10):4478-504 | |
NP00387 |
LPVYNFGL
|
8 | Daphnia pulex | Allatostatin | Allatostatin A6 | 21830762#Dircksen H, Neupert S, Predel R, Verleyen P, Huybrechts J, Strauss J, Hauser F, Stafflinger E, Schneider M, Pauwels K, Schoofs L, Grimmelikhuijzen CJ#Genomics, transcriptomics, and peptidomics of Daphnia pulex neuropeptides and protein hormones#J Proteome Res 2011 Oct 7;10(10):4478-504 | |
NP00388 |
NNWNRMQGMW
|
10 | Daphnia pulex | Allatostatin | Allatostatin B1 | 21830762#Dircksen H, Neupert S, Predel R, Verleyen P, Huybrechts J, Strauss J, Hauser F, Stafflinger E, Schneider M, Pauwels K, Schoofs L, Grimmelikhuijzen CJ#Genomics, transcriptomics, and peptidomics of Daphnia pulex neuropeptides and protein hormones#J Proteome Res 2011 Oct 7;10(10):4478-504 | |
NP00389 |
AWSDLSQQGW
|
10 | Daphnia pulex | Allatostatin | Allatostatin B2 | 21830762#Dircksen H, Neupert S, Predel R, Verleyen P, Huybrechts J, Strauss J, Hauser F, Stafflinger E, Schneider M, Pauwels K, Schoofs L, Grimmelikhuijzen CJ#Genomics, transcriptomics, and peptidomics of Daphnia pulex neuropeptides and protein hormones#J Proteome Res 2011 Oct 7;10(10):4478-504 | |
NP00390 |
SWTQLHGVW
|
9 | Daphnia pulex | Allatostatin | Allatostatin B3 | 21830762#Dircksen H, Neupert S, Predel R, Verleyen P, Huybrechts J, Strauss J, Hauser F, Stafflinger E, Schneider M, Pauwels K, Schoofs L, Grimmelikhuijzen CJ#Genomics, transcriptomics, and peptidomics of Daphnia pulex neuropeptides and protein hormones#J Proteome Res 2011 Oct 7;10(10):4478-504 | |
NP00391 |
RWDQLHGAW
|
9 | Daphnia pulex | Allatostatin | Allatostatin B4 | 21830762#Dircksen H, Neupert S, Predel R, Verleyen P, Huybrechts J, Strauss J, Hauser F, Stafflinger E, Schneider M, Pauwels K, Schoofs L, Grimmelikhuijzen CJ#Genomics, transcriptomics, and peptidomics of Daphnia pulex neuropeptides and protein hormones#J Proteome Res 2011 Oct 7;10(10):4478-504 | |
NP00392 |
SGWNKMQGVW
|
10 | Daphnia pulex | Allatostatin | Allatostatin B5 | 21830762#Dircksen H, Neupert S, Predel R, Verleyen P, Huybrechts J, Strauss J, Hauser F, Stafflinger E, Schneider M, Pauwels K, Schoofs L, Grimmelikhuijzen CJ#Genomics, transcriptomics, and peptidomics of Daphnia pulex neuropeptides and protein hormones#J Proteome Res 2011 Oct 7;10(10):4478-504 | |
NP00393 |
GWNQLQGVW
|
9 | Daphnia pulex | Allatostatin | Allatostatin B6 | 21830762#Dircksen H, Neupert S, Predel R, Verleyen P, Huybrechts J, Strauss J, Hauser F, Stafflinger E, Schneider M, Pauwels K, Schoofs L, Grimmelikhuijzen CJ#Genomics, transcriptomics, and peptidomics of Daphnia pulex neuropeptides and protein hormones#J Proteome Res 2011 Oct 7;10(10):4478-504 | |
NP00394 |
NWNNLRGAW
|
9 | Daphnia pulex | Allatostatin | Allatostatin B7 | 21830762#Dircksen H, Neupert S, Predel R, Verleyen P, Huybrechts J, Strauss J, Hauser F, Stafflinger E, Schneider M, Pauwels K, Schoofs L, Grimmelikhuijzen CJ#Genomics, transcriptomics, and peptidomics of Daphnia pulex neuropeptides and protein hormones#J Proteome Res 2011 Oct 7;10(10):4478-504 | |
NP00395 |
ESGWNNLKGLW
|
11 | Daphnia pulex | Allatostatin | Allatostatin B8 | 21830762#Dircksen H, Neupert S, Predel R, Verleyen P, Huybrechts J, Strauss J, Hauser F, Stafflinger E, Schneider M, Pauwels K, Schoofs L, Grimmelikhuijzen CJ#Genomics, transcriptomics, and peptidomics of Daphnia pulex neuropeptides and protein hormones#J Proteome Res 2011 Oct 7;10(10):4478-504 | |
NP00396 |
SYWKQCAFNAVSCF
|
14 | Daphnia pulex | Allatostatin | Allatostatin C1 | 21830762#Dircksen H, Neupert S, Predel R, Verleyen P, Huybrechts J, Strauss J, Hauser F, Stafflinger E, Schneider M, Pauwels K, Schoofs L, Grimmelikhuijzen CJ#Genomics, transcriptomics, and peptidomics of Daphnia pulex neuropeptides and protein hormones#J Proteome Res 2011 Oct 7;10(10):4478-504 | |
NP00397 |
GQSSQRVFWRCYFNAVSCF
|
19 | Daphnia pulex | Allatostatin | Allatostatin C2 | 21830762#Dircksen H, Neupert S, Predel R, Verleyen P, Huybrechts J, Strauss J, Hauser F, Stafflinger E, Schneider M, Pauwels K, Schoofs L, Grimmelikhuijzen CJ#Genomics, transcriptomics, and peptidomics of Daphnia pulex neuropeptides and protein hormones#J Proteome Res 2011 Oct 7;10(10):4478-504 | |
NP00398 |
SKQLRYHHCYFNPISCF
|
17 | Daphnia pulex | Allatostatin | Allatostatin C3 | 21830762#Dircksen H, Neupert S, Predel R, Verleyen P, Huybrechts J, Strauss J, Hauser F, Stafflinger E, Schneider M, Pauwels K, Schoofs L, Grimmelikhuijzen CJ#Genomics, transcriptomics, and peptidomics of Daphnia pulex neuropeptides and protein hormones#J Proteome Res 2011 Oct 7;10(10):4478-504 | |
NP00399 |
AYSYVSEYKRLPVYSFGL
|
18 | Diploptera punctata | Allatostatin | Allatostatin B | 10545101#Birgül N, Weise C, Kreienkamp HJ, Richter D#Reverse physiology in drosophila: identification of a novel allatostatin-like neuropeptide and its cognate receptor structurally related to the mammalian somatostatin/galanin/opioid receptor family#EMBO J 1999 Nov 1;18(21):5892-900 | |
NP00400 |
EAQGWNKFRGAW
|
12 | Drosophila melanogaster | Allatostatin | MIP3 | 16061202#Husson SJ, Clynen E, Baggerman G, De Loof A, Schoofs L#Discovering neuropeptides in Caenorhabditis elegans by two dimensional liquid chromatography and mass spectrometry#Biochem Biophys Res Commun 2005 Sep 16;335(1):76-86 | |
NP00401 |
SRPYLFGL
|
8 | Galleria mellonella | Allatostatin | Bom-AST-3 | 15706623#Huybrechts J, Verleyen P, Schoofs L#Mass spectrometric analysis of head ganglia and neuroendocrine tissue of larval Galleria mellonella (Arthropoda, Insecta)#J Mass Spectrom 2005 Feb;40(2):271-6 | |
NP00402 |
ARPYSFGL
|
8 | Galleria mellonella | Allatostatin | Bom-AST-4 | 15706623#Huybrechts J, Verleyen P, Schoofs L#Mass spectrometric analysis of head ganglia and neuroendocrine tissue of larval Galleria mellonella (Arthropoda, Insecta)#J Mass Spectrom 2005 Feb;40(2):271-6 | |
NP00403 |
LSSKFNFGL
|
9 | Galleria mellonella | Allatostatin | Bom-AST-7 | 15706623#Huybrechts J, Verleyen P, Schoofs L#Mass spectrometric analysis of head ganglia and neuroendocrine tissue of larval Galleria mellonella (Arthropoda, Insecta)#J Mass Spectrom 2005 Feb;40(2):271-6 | |
NP00404 |
SRPYSFGL
|
8 | Galleria mellonella | Allatostatin | Hea-AST-7 | 15706623#Huybrechts J, Verleyen P, Schoofs L#Mass spectrometric analysis of head ganglia and neuroendocrine tissue of larval Galleria mellonella (Arthropoda, Insecta)#J Mass Spectrom 2005 Feb;40(2):271-6 | |
NP00405 |
SPHYDFGL
|
8 | Galleria mellonella | Allatostatin | Helicostatin-1 | 15706623#Huybrechts J, Verleyen P, Schoofs L#Mass spectrometric analysis of head ganglia and neuroendocrine tissue of larval Galleria mellonella (Arthropoda, Insecta)#J Mass Spectrom 2005 Feb;40(2):271-6 | |
NP00406 |
GWQDLNGGW
|
9 | Gryllus bimaculatus | Allatostatin | Grb-AST-B1 | 16061202#Husson SJ, Clynen E, Baggerman G, De Loof A, Schoofs L#Discovering neuropeptides in Caenorhabditis elegans by two dimensional liquid chromatography and mass spectrometry#Biochem Biophys Res Commun 2005 Sep 16;335(1):76-86 | |
NP00407 |
GWRDLNGGW
|
9 | Gryllus bimaculatus | Allatostatin | Grb-AST-B2 | 16061202#Husson SJ, Clynen E, Baggerman G, De Loof A, Schoofs L#Discovering neuropeptides in Caenorhabditis elegans by two dimensional liquid chromatography and mass spectrometry#Biochem Biophys Res Commun 2005 Sep 16;335(1):76-86 | |
NP00408 |
AWRDLSGGW
|
9 | Gryllus bimaculatus | Allatostatin | Grb-AST-B3 | 16061202#Husson SJ, Clynen E, Baggerman G, De Loof A, Schoofs L#Discovering neuropeptides in Caenorhabditis elegans by two dimensional liquid chromatography and mass spectrometry#Biochem Biophys Res Commun 2005 Sep 16;335(1):76-86 | |
NP00409 |
AWERFHGSW
|
9 | Gryllus bimaculatus | Allatostatin | Grb-AST-B4 | 16061202#Husson SJ, Clynen E, Baggerman G, De Loof A, Schoofs L#Discovering neuropeptides in Caenorhabditis elegans by two dimensional liquid chromatography and mass spectrometry#Biochem Biophys Res Commun 2005 Sep 16;335(1):76-86 | |
NP00410 |
AWQDLNAGW
|
9 | Gryllus bimaculatus | Allatostatin | Locustamyoinhibiting peptide | 7673141#Lorenz MW, Kellner R, Hoffmann KH#A family of neuropeptides that inhibit juvenile hormone biosynthesis in the cricket, Gryllus bimaculatus#J Biol Chem 1995 Sep 8;270(36):21103-8 | |
NP00411 |
AGGAYSFGL
|
9 | Homarus americanus | Allatostatin | Allatostatin A | 18304551#Ma M, Chen R, Sousa GL, Bors EK, Kwiatkowski MA, Goiney CC, Goy MF, Christie AE, Li L#Mass spectral characterization of peptide transmitters/hormones in the nervous system and neuroendocrine organs of the American lobster Homarus americanus#Gen Comp Endocrinol 2008 Apr 1;156(2):395-409 | |
NP00412 |
AGPYAFGL
|
8 | Homarus americanus | Allatostatin | Allatostatin A | 18304551#Ma M, Chen R, Sousa GL, Bors EK, Kwiatkowski MA, Goiney CC, Goy MF, Christie AE, Li L#Mass spectral characterization of peptide transmitters/hormones in the nervous system and neuroendocrine organs of the American lobster Homarus americanus#Gen Comp Endocrinol 2008 Apr 1;156(2):395-409 | |
NP00413 |
AGPYSFGL
|
8 | Homarus americanus | Allatostatin | Allatostatin A | 18088365#Cape SS, Rehm KJ, Ma M, Marder E, Li L#Mass spectral comparison of the neuropeptide complement of the stomatogastric ganglion and brain in the adult and embryonic lobster, Homarus americanus#J Neurochem 2008 May;105(3):690-702 | |
NP00414 |
ASPYAFGL
|
8 | Homarus americanus | Allatostatin | Allatostatin A | 20025296#Chen R, Jiang X, Conaway MC, Mohtashemi I, Hui L, Viner R, Li L#Mass spectral analysis of neuropeptide expression and distribution in the nervous system of the lobster Homarus americanus#J Proteome Res 2010 Feb 5;9(2):818-32 | |
NP00415 |
EPYAFGL
|
7 | Homarus americanus | Allatostatin | Allatostatin A | 18304551#Ma M, Chen R, Sousa GL, Bors EK, Kwiatkowski MA, Goiney CC, Goy MF, Christie AE, Li L#Mass spectral characterization of peptide transmitters/hormones in the nervous system and neuroendocrine organs of the American lobster Homarus americanus#Gen Comp Endocrinol 2008 Apr 1;156(2):395-409 | |
NP00416 |
ERAYSFGL
|
8 | Homarus americanus | Allatostatin | Allatostatin A | 20025296#Chen R, Jiang X, Conaway MC, Mohtashemi I, Hui L, Viner R, Li L#Mass spectral analysis of neuropeptide expression and distribution in the nervous system of the lobster Homarus americanus#J Proteome Res 2010 Feb 5;9(2):818-32 | |
NP00417 |
PRDYAFGL
|
8 | Homarus americanus | Allatostatin | Allatostatin A | 22860213#Jiang X, Chen R, Wang J, Metzler A, Tlusty M, Li L#Mass spectral charting of neuropeptidomic expression in the stomatogastric ganglion at multiple developmental stages of the lobster Homarus americanus#ACS Chem Neurosci 2012 Jun 20;3(6):439-50 | |
NP00418 |
PRNYAFGL
|
8 | Homarus americanus | Allatostatin | Allatostatin A | 22860213#Jiang X, Chen R, Wang J, Metzler A, Tlusty M, Li L#Mass spectral charting of neuropeptidomic expression in the stomatogastric ganglion at multiple developmental stages of the lobster Homarus americanus#ACS Chem Neurosci 2012 Jun 20;3(6):439-50 | |
NP00419 |
RQYAFGL
|
7 | Homarus americanus | Allatostatin | Allatostatin A | 22860213#Jiang X, Chen R, Wang J, Metzler A, Tlusty M, Li L#Mass spectral charting of neuropeptidomic expression in the stomatogastric ganglion at multiple developmental stages of the lobster Homarus americanus#ACS Chem Neurosci 2012 Jun 20;3(6):439-50 | |
NP00420 |
SGPYAFGL
|
8 | Homarus americanus | Allatostatin | Allatostatin A | 18304551#Ma M, Chen R, Sousa GL, Bors EK, Kwiatkowski MA, Goiney CC, Goy MF, Christie AE, Li L#Mass spectral characterization of peptide transmitters/hormones in the nervous system and neuroendocrine organs of the American lobster Homarus americanus#Gen Comp Endocrinol 2008 Apr 1;156(2):395-409 | |
NP00421 |
SGPYSFGL
|
8 | Homarus americanus | Allatostatin | Allatostatin A | 18304551#Ma M, Chen R, Sousa GL, Bors EK, Kwiatkowski MA, Goiney CC, Goy MF, Christie AE, Li L#Mass spectral characterization of peptide transmitters/hormones in the nervous system and neuroendocrine organs of the American lobster Homarus americanus#Gen Comp Endocrinol 2008 Apr 1;156(2):395-409 | |
NP00422 |
SPYAFGL
|
7 | Homarus americanus | Allatostatin | Allatostatin A | 18304551#Ma M, Chen R, Sousa GL, Bors EK, Kwiatkowski MA, Goiney CC, Goy MF, Christie AE, Li L#Mass spectral characterization of peptide transmitters/hormones in the nervous system and neuroendocrine organs of the American lobster Homarus americanus#Gen Comp Endocrinol 2008 Apr 1;156(2):395-409 | |
NP00423 |
SQYTFGL
|
7 | Homarus americanus | Allatostatin | Allatostatin A | 18304551#Ma M, Chen R, Sousa GL, Bors EK, Kwiatkowski MA, Goiney CC, Goy MF, Christie AE, Li L#Mass spectral characterization of peptide transmitters/hormones in the nervous system and neuroendocrine organs of the American lobster Homarus americanus#Gen Comp Endocrinol 2008 Apr 1;156(2):395-409 | |
NP00424 |
TPSYAFGL
|
8 | Homarus americanus | Allatostatin | Allatostatin A | 18304551#Ma M, Chen R, Sousa GL, Bors EK, Kwiatkowski MA, Goiney CC, Goy MF, Christie AE, Li L#Mass spectral characterization of peptide transmitters/hormones in the nervous system and neuroendocrine organs of the American lobster Homarus americanus#Gen Comp Endocrinol 2008 Apr 1;156(2):395-409 | |
NP00425 |
VGPYAFGL
|
8 | Homarus americanus | Allatostatin | Allatostatin A | 18304551#Ma M, Chen R, Sousa GL, Bors EK, Kwiatkowski MA, Goiney CC, Goy MF, Christie AE, Li L#Mass spectral characterization of peptide transmitters/hormones in the nervous system and neuroendocrine organs of the American lobster Homarus americanus#Gen Comp Endocrinol 2008 Apr 1;156(2):395-409 | |
NP00426 |
VPRYAFG
|
7 | Homarus americanus | Allatostatin | Allatostatin A | 20025296#Chen R, Jiang X, Conaway MC, Mohtashemi I, Hui L, Viner R, Li L#Mass spectral analysis of neuropeptide expression and distribution in the nervous system of the lobster Homarus americanus#J Proteome Res 2010 Feb 5;9(2):818-32 | |
NP00427 |
GNWNKFQGSW
|
10 | Homarus americanus | Allatostatin | Allatostatin B | 18304551#Ma M, Chen R, Sousa GL, Bors EK, Kwiatkowski MA, Goiney CC, Goy MF, Christie AE, Li L#Mass spectral characterization of peptide transmitters/hormones in the nervous system and neuroendocrine organs of the American lobster Homarus americanus#Gen Comp Endocrinol 2008 Apr 1;156(2):395-409 | |
NP00428 |
NWNKFQGSW
|
9 | Homarus americanus | Allatostatin | Allatostatin B | 18304551#Ma M, Chen R, Sousa GL, Bors EK, Kwiatkowski MA, Goiney CC, Goy MF, Christie AE, Li L#Mass spectral characterization of peptide transmitters/hormones in the nervous system and neuroendocrine organs of the American lobster Homarus americanus#Gen Comp Endocrinol 2008 Apr 1;156(2):395-409 | |
NP00429 |
STNWSSLRSAW
|
11 | Homarus americanus | Allatostatin | Allatostatin B | 22860213#Jiang X, Chen R, Wang J, Metzler A, Tlusty M, Li L#Mass spectral charting of neuropeptidomic expression in the stomatogastric ganglion at multiple developmental stages of the lobster Homarus americanus#ACS Chem Neurosci 2012 Jun 20;3(6):439-50 | |
NP00430 |
TNWNKFQGSW
|
10 | Homarus americanus | Allatostatin | Allatostatin B | 22860213#Jiang X, Chen R, Wang J, Metzler A, Tlusty M, Li L#Mass spectral charting of neuropeptidomic expression in the stomatogastric ganglion at multiple developmental stages of the lobster Homarus americanus#ACS Chem Neurosci 2012 Jun 20;3(6):439-50 | |
NP00431 |
QIRYHQCYFNPISCF
|
15 | Homarus americanus | Allatostatin | Allatostatin C | 20025296#Chen R, Jiang X, Conaway MC, Mohtashemi I, Hui L, Viner R, Li L#Mass spectral analysis of neuropeptide expression and distribution in the nervous system of the lobster Homarus americanus#J Proteome Res 2010 Feb 5;9(2):818-32 | |
NP00432 |
SGWKQCSFNAVSCF
|
14 | Ixodes scapularis | Allatostatin | Allatostatin-C | 19540946#Neupert S, Russell WK, Predel R, Russell DH, Strey OF, Teel PD, Nachman RJ#The neuropeptidomics of Ixodes scapularis synganglion#J Proteomics 2009 Aug 20;72(6):1040-5 | |
NP00433 |
ASDWNRLSGMW
|
11 | Ixodes scapularis | Allatostatin | Myoinhibitory peptide | 19540946#Neupert S, Russell WK, Predel R, Russell DH, Strey OF, Teel PD, Nachman RJ#The neuropeptidomics of Ixodes scapularis synganglion#J Proteomics 2009 Aug 20;72(6):1040-5 | |
NP00434 |
ANQYAFGL
|
8 | Litopenaeus vannamei | Allatostatin | Allatostatin A | 19852991#Ma M, Gard AL, Xiang F, Wang J, Davoodian N, Lenz PH, Malecha SR, Christie AE, Li L#Combining in silico transcriptome mining and biological mass spectrometry for neuropeptide discovery in the Pacific white shrimp Litopenaeus vannamei#Peptides 2010 Jan;31(1):27-43 | |
NP00435 |
DRLYAFGL
|
8 | Litopenaeus vannamei | Allatostatin | Allatostatin A | 19852991#Ma M, Gard AL, Xiang F, Wang J, Davoodian N, Lenz PH, Malecha SR, Christie AE, Li L#Combining in silico transcriptome mining and biological mass spectrometry for neuropeptide discovery in the Pacific white shrimp Litopenaeus vannamei#Peptides 2010 Jan;31(1):27-43 | |
NP00436 |
HGSYAFGL
|
8 | Litopenaeus vannamei | Allatostatin | Allatostatin A | 19852991#Ma M, Gard AL, Xiang F, Wang J, Davoodian N, Lenz PH, Malecha SR, Christie AE, Li L#Combining in silico transcriptome mining and biological mass spectrometry for neuropeptide discovery in the Pacific white shrimp Litopenaeus vannamei#Peptides 2010 Jan;31(1):27-43 | |
NP00437 |
SSKPYAFGL
|
9 | Litopenaeus vannamei | Allatostatin | Allatostatin A | 19852991#Ma M, Gard AL, Xiang F, Wang J, Davoodian N, Lenz PH, Malecha SR, Christie AE, Li L#Combining in silico transcriptome mining and biological mass spectrometry for neuropeptide discovery in the Pacific white shrimp Litopenaeus vannamei#Peptides 2010 Jan;31(1):27-43 | |
NP00438 |
ADWNKFQGSW
|
10 | Litopenaeus vannamei | Allatostatin | Allatostatin B | 19852991#Ma M, Gard AL, Xiang F, Wang J, Davoodian N, Lenz PH, Malecha SR, Christie AE, Li L#Combining in silico transcriptome mining and biological mass spectrometry for neuropeptide discovery in the Pacific white shrimp Litopenaeus vannamei#Peptides 2010 Jan;31(1):27-43 | |
NP00439 |
KWAAGRSAW
|
9 | Litopenaeus vannamei | Allatostatin | Allatostatin B | 19852991#Ma M, Gard AL, Xiang F, Wang J, Davoodian N, Lenz PH, Malecha SR, Christie AE, Li L#Combining in silico transcriptome mining and biological mass spectrometry for neuropeptide discovery in the Pacific white shrimp Litopenaeus vannamei#Peptides 2010 Jan;31(1):27-43 | |
NP00440 |
LTWNKFQGSW
|
10 | Litopenaeus vannamei | Allatostatin | Allatostatin B | 19852991#Ma M, Gard AL, Xiang F, Wang J, Davoodian N, Lenz PH, Malecha SR, Christie AE, Li L#Combining in silico transcriptome mining and biological mass spectrometry for neuropeptide discovery in the Pacific white shrimp Litopenaeus vannamei#Peptides 2010 Jan;31(1):27-43 | |
NP00441 |
NWNKFQGSW
|
9 | Litopenaeus vannamei | Allatostatin | Allatostatin B | 19852991#Ma M, Gard AL, Xiang F, Wang J, Davoodian N, Lenz PH, Malecha SR, Christie AE, Li L#Combining in silico transcriptome mining and biological mass spectrometry for neuropeptide discovery in the Pacific white shrimp Litopenaeus vannamei#Peptides 2010 Jan;31(1):27-43 | |
NP00442 |
RWSKFQGSW
|
9 | Litopenaeus vannamei | Allatostatin | Allatostatin B | 19852991#Ma M, Gard AL, Xiang F, Wang J, Davoodian N, Lenz PH, Malecha SR, Christie AE, Li L#Combining in silico transcriptome mining and biological mass spectrometry for neuropeptide discovery in the Pacific white shrimp Litopenaeus vannamei#Peptides 2010 Jan;31(1):27-43 | |
NP00443 |
SADWNSLRGTW
|
11 | Litopenaeus vannamei | Allatostatin | Allatostatin B | 19852991#Ma M, Gard AL, Xiang F, Wang J, Davoodian N, Lenz PH, Malecha SR, Christie AE, Li L#Combining in silico transcriptome mining and biological mass spectrometry for neuropeptide discovery in the Pacific white shrimp Litopenaeus vannamei#Peptides 2010 Jan;31(1):27-43 | |
NP00444 |
STNWSNLRGTW
|
11 | Litopenaeus vannamei | Allatostatin | Allatostatin B | 19852991#Ma M, Gard AL, Xiang F, Wang J, Davoodian N, Lenz PH, Malecha SR, Christie AE, Li L#Combining in silico transcriptome mining and biological mass spectrometry for neuropeptide discovery in the Pacific white shrimp Litopenaeus vannamei#Peptides 2010 Jan;31(1):27-43 | |
NP00445 |
VPNDWAHFRGSW
|
12 | Litopenaeus vannamei | Allatostatin | Allatostatin B | 19852991#Ma M, Gard AL, Xiang F, Wang J, Davoodian N, Lenz PH, Malecha SR, Christie AE, Li L#Combining in silico transcriptome mining and biological mass spectrometry for neuropeptide discovery in the Pacific white shrimp Litopenaeus vannamei#Peptides 2010 Jan;31(1):27-43 | |
NP00446 |
VERYAFGL
|
8 | Lucilia cuprina | Allatostatin | Allatostatin 1 | 23280433#Rahman MM, Neupert S, Predel R#Neuropeptidomics of the Australian sheep blowfly Lucilia cuprina (Wiedemann) and related Diptera#Peptides 2013 Mar;41:31-7 | |
NP00447 |
ARPYSFGL
|
8 | Lucilia cuprina | Allatostatin | Allatostatin 3 | 23280433#Rahman MM, Neupert S, Predel R#Neuropeptidomics of the Australian sheep blowfly Lucilia cuprina (Wiedemann) and related Diptera#Peptides 2013 Mar;41:31-7 | |
NP00448 |
NRPYSFGL
|
8 | Lucilia cuprina | Allatostatin | Allatostatin-4 | 23280433#Rahman MM, Neupert S, Predel R#Neuropeptidomics of the Australian sheep blowfly Lucilia cuprina (Wiedemann) and related Diptera#Peptides 2013 Mar;41:31-7 | |
NP00449 |
DPLNEERRANRYGFGL
|
16 | Lucilia cuprina | Allatostatin | Allatostatin-5 | 23280433#Rahman MM, Neupert S, Predel R#Neuropeptidomics of the Australian sheep blowfly Lucilia cuprina (Wiedemann) and related Diptera#Peptides 2013 Mar;41:31-7 | |
NP00450 |
ANRYGFGL
|
8 | Lucilia cuprina | Allatostatin | Callatostatin-3 | 23280433#Rahman MM, Neupert S, Predel R#Neuropeptidomics of the Australian sheep blowfly Lucilia cuprina (Wiedemann) and related Diptera#Peptides 2013 Mar;41:31-7 | |
NP00451 |
EVRFRQCYFNPISCF
|
15 | Manduca sexta | Allatostatin | Allatostatin | 14599724#Audsley N, Weaver RJ#A comparison of the neuropeptides from the retrocerebral complex of adult male and female Manduca sexta using MALDI-TOF mass spectrometry#Regul Pept 2003 Nov 15;116(1-3):127-37 | |
NP00452 |
AYSYVSEYKRLPVYNFGL
|
18 | Manduca sexta | Allatostatin | Cydiastatin 2 | 14599724#Audsley N, Weaver RJ#A comparison of the neuropeptides from the retrocerebral complex of adult male and female Manduca sexta using MALDI-TOF mass spectrometry#Regul Pept 2003 Nov 15;116(1-3):127-37 | |
NP00453 |
LPVYNFGL
|
8 | Manduca sexta | Allatostatin | Cydiastatin 2 11–18 | 14599724#Audsley N, Weaver RJ#A comparison of the neuropeptides from the retrocerebral complex of adult male and female Manduca sexta using MALDI-TOF mass spectrometry#Regul Pept 2003 Nov 15;116(1-3):127-37 | |
NP00454 |
SRPYSFGL
|
8 | Manduca sexta | Allatostatin | Cydiastatin 3 | 14599724#Audsley N, Weaver RJ#A comparison of the neuropeptides from the retrocerebral complex of adult male and female Manduca sexta using MALDI-TOF mass spectrometry#Regul Pept 2003 Nov 15;116(1-3):127-37 | |
NP00455 |
ARPYSFGL
|
8 | Manduca sexta | Allatostatin | Cydiastatin 4 | 14599724#Audsley N, Weaver RJ#A comparison of the neuropeptides from the retrocerebral complex of adult male and female Manduca sexta using MALDI-TOF mass spectrometry#Regul Pept 2003 Nov 15;116(1-3):127-37 | |
NP00456 |
SPHYDFGL
|
8 | Manduca sexta | Allatostatin | Helicostatin-1 | 14599724#Audsley N, Weaver RJ#A comparison of the neuropeptides from the retrocerebral complex of adult male and female Manduca sexta using MALDI-TOF mass spectrometry#Regul Pept 2003 Nov 15;116(1-3):127-37 | |
NP00457 |
ARAYDFGL
|
8 | Manduca sexta | Allatostatin | Helicostatin-5 | 14706525#Audsley N, Weaver RJ#Identification of neuropeptides from brains of larval Manduca sexta and Lacanobia oleracea using MALDI-TOF mass spectrometry and post-source decay#Peptides 2003 Oct;24(10):1465-74 | |
NP00458 |
LPMYNFGL
|
8 | Manduca sexta | Allatostatin | Helicostatin-6 | 14599724#Audsley N, Weaver RJ#A comparison of the neuropeptides from the retrocerebral complex of adult male and female Manduca sexta using MALDI-TOF mass spectrometry#Regul Pept 2003 Nov 15;116(1-3):127-37 | |
NP00459 |
ARSYNFGL
|
8 | Manduca sexta | Allatostatin | Helicostatin-7 | 14599724#Audsley N, Weaver RJ#A comparison of the neuropeptides from the retrocerebral complex of adult male and female Manduca sexta using MALDI-TOF mass spectrometry#Regul Pept 2003 Nov 15;116(1-3):127-37 | |
NP00460 |
ERDMHRFSFGL
|
11 | Manduca sexta | Allatostatin | Helicostatin-9 | 14706525#Audsley N, Weaver RJ#Identification of neuropeptides from brains of larval Manduca sexta and Lacanobia oleracea using MALDI-TOF mass spectrometry and post-source decay#Peptides 2003 Oct;24(10):1465-74 | |
NP00461 |
GWQDLNSAW
|
9 | Manduca sexta | Allatostatin | Mas-MIP II | 16061202#Husson SJ, Clynen E, Baggerman G, De Loof A, Schoofs L#Discovering neuropeptides in Caenorhabditis elegans by two dimensional liquid chromatography and mass spectrometry#Biochem Biophys Res Commun 2005 Sep 16;335(1):76-86 | |
NP00462 |
AWQDLNSAW
|
9 | Manduca sexta | Allatostatin | Mas-MIP1 | 16061202#Husson SJ, Clynen E, Baggerman G, De Loof A, Schoofs L#Discovering neuropeptides in Caenorhabditis elegans by two dimensional liquid chromatography and mass spectrometry#Biochem Biophys Res Commun 2005 Sep 16;335(1):76-86 | |
NP00463 |
APEKWAAFHGSW
|
12 | Manduca sexta | Allatostatin | MIP III | 14599724#Audsley N, Weaver RJ#A comparison of the neuropeptides from the retrocerebral complex of adult male and female Manduca sexta using MALDI-TOF mass spectrometry#Regul Pept 2003 Nov 15;116(1-3):127-37 | |
NP00464 |
GWQDMSSAW
|
9 | Manduca sexta | Allatostatin | MIP V | 14599724#Audsley N, Weaver RJ#A comparison of the neuropeptides from the retrocerebral complex of adult male and female Manduca sexta using MALDI-TOF mass spectrometry#Regul Pept 2003 Nov 15;116(1-3):127-37 | |
NP00465 |
AWSALHGAW
|
9 | Manduca sexta | Allatostatin | MIP VI | 14599724#Audsley N, Weaver RJ#A comparison of the neuropeptides from the retrocerebral complex of adult male and female Manduca sexta using MALDI-TOF mass spectrometry#Regul Pept 2003 Nov 15;116(1-3):127-37 | |
NP00466 |
LPIYQFGL
|
8 | Nasonia vitripennis | Allatostatin | Allatostatin-A-1 | 20695486#Hauser F, Neupert S, Williamson M, Predel R, Tanaka Y, Grimmelikhuijzen CJ#Genomics and peptidomics of neuropeptides and protein hormones present in the parasitic wasp Nasonia vitripennis#J Proteome Res 2010 Oct 1;9(10):5296-310 | |
NP00467 |
SQPFSFGL
|
8 | Nasonia vitripennis | Allatostatin | Allatostatin-A-2 | 20695486#Hauser F, Neupert S, Williamson M, Predel R, Tanaka Y, Grimmelikhuijzen CJ#Genomics and peptidomics of neuropeptides and protein hormones present in the parasitic wasp Nasonia vitripennis#J Proteome Res 2010 Oct 1;9(10):5296-310 | |
NP00468 |
TRPYSFGL
|
8 | Nasonia vitripennis | Allatostatin | Allatostatin-A-3 | 20695486#Hauser F, Neupert S, Williamson M, Predel R, Tanaka Y, Grimmelikhuijzen CJ#Genomics and peptidomics of neuropeptides and protein hormones present in the parasitic wasp Nasonia vitripennis#J Proteome Res 2010 Oct 1;9(10):5296-310 | |
NP00469 |
DKYLFGL
|
7 | Nasonia vitripennis | Allatostatin | Allatostatin-A-5 | 20695486#Hauser F, Neupert S, Williamson M, Predel R, Tanaka Y, Grimmelikhuijzen CJ#Genomics and peptidomics of neuropeptides and protein hormones present in the parasitic wasp Nasonia vitripennis#J Proteome Res 2010 Oct 1;9(10):5296-310 | |
NP00470 |
AGPYAFGL
|
8 | Ocypode ceratophthalma | Allatostatin | Allatostatin A | 23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34 | |
NP00471 |
ARPYSFGL
|
8 | Ocypode ceratophthalma | Allatostatin | Allatostatin A | 23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34 | |
NP00472 |
DGPYSFGL
|
8 | Ocypode ceratophthalma | Allatostatin | Allatostatin A | 23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34 | |
NP00473 |
EAYAGFL
|
7 | Ocypode ceratophthalma | Allatostatin | Allatostatin A | 23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34 | |
NP00474 |
EPQYSFGL
|
8 | Ocypode ceratophthalma | Allatostatin | Allatostatin A | 23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34 | |
NP00475 |
EPYAFGL
|
7 | Ocypode ceratophthalma | Allatostatin | Allatostatin A | 23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34 | |
NP00476 |
FSGASPYGL
|
9 | Ocypode ceratophthalma | Allatostatin | Allatostatin A | 23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34 | |
NP00477 |
KLPTGYQFGL
|
10 | Ocypode ceratophthalma | Allatostatin | Allatostatin A | 23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34 | |
NP00478 |
PRDYAFGL
|
8 | Ocypode ceratophthalma | Allatostatin | Allatostatin A | 23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34 | |
NP00479 |
RGPYAFGL
|
8 | Ocypode ceratophthalma | Allatostatin | Allatostatin A | 23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34 | |
NP00480 |
SDMYSFGL
|
8 | Ocypode ceratophthalma | Allatostatin | Allatostatin A | 23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34 | |
NP00481 |
SGHYIFGL
|
8 | Ocypode ceratophthalma | Allatostatin | Allatostatin A | 23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34 | |
NP00482 |
SNPYSFGL
|
8 | Ocypode ceratophthalma | Allatostatin | Allatostatin A | 23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34 | |
NP00483 |
SRPYSFGL
|
8 | Ocypode ceratophthalma | Allatostatin | Allatostatin A | 23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34 | |
NP00484 |
TRPYSFGL
|
8 | Ocypode ceratophthalma | Allatostatin | Allatostatin A | 23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34 | |
NP00485 |
YDFEASSYSFGL
|
12 | Ocypode ceratophthalma | Allatostatin | Allatostatin A | 23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34 | |
NP00486 |
AWSNLGQAW
|
9 | Ocypode ceratophthalma | Allatostatin | Allatostatin B | 23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34 | |
NP00487 |
DDWSQFQGSW
|
10 | Ocypode ceratophthalma | Allatostatin | Allatostatin B | 23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34 | |
NP00488 |
DGSSNLRGAW
|
10 | Ocypode ceratophthalma | Allatostatin | Allatostatin B | 23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34 | |
NP00489 |
GNWNKFQGSW
|
10 | Ocypode ceratophthalma | Allatostatin | Allatostatin B | 23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34 | |
NP00490 |
NNWSKFQGSW
|
10 | Ocypode ceratophthalma | Allatostatin | Allatostatin B | 23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34 | |
NP00491 |
SDGWSPSGDGSW
|
12 | Ocypode ceratophthalma | Allatostatin | Allatostatin B | 23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34 | |
NP00492 |
SGDWSSLRGAW
|
11 | Ocypode ceratophthalma | Allatostatin | Allatostatin B | 23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34 | |
NP00493 |
SPNDWAHFRGSW
|
12 | Ocypode ceratophthalma | Allatostatin | Allatostatin B | 23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34 | |
NP00494 |
STNWSSCPTSAW
|
12 | Ocypode ceratophthalma | Allatostatin | Allatostatin B | 23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34 | |
NP00495 |
STNWSSLRSAW
|
11 | Ocypode ceratophthalma | Allatostatin | Allatostatin B | 23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34 | |
NP00496 |
TGWSSTSRAW
|
10 | Ocypode ceratophthalma | Allatostatin | Allatostatin B | 23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34 | |
NP00497 |
TGWSVFQGSW
|
10 | Ocypode ceratophthalma | Allatostatin | Allatostatin B | 23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34 | |
NP00498 |
TQWSKFQGSW
|
10 | Ocypode ceratophthalma | Allatostatin | Allatostatin B | 23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34 | |
NP00499 |
TSWGKFQGSW
|
10 | Ocypode ceratophthalma | Allatostatin | Allatostatin B | 23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34 | |
NP00500 |
TSWGKYQGSW
|
10 | Ocypode ceratophthalma | Allatostatin | Allatostatin B | 23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34 | |
NP00501 |
ANEDEDAASLFAFGL
|
15 | Penaeus monodon | Allatostatin | Allatostatin | 21459120#Chansela P, Goto-Inoue N, Zaima N, Sroyraya M, Sobhon P, Setou M#Visualization of neuropeptides in paraffin-embedded tissue sections of the central nervous system in the decapod crustacean, Penaeus monodon, by imaging mass spectrometry#Peptides 2012 Mar;34(1):10-8 | |
NP00502 |
SGHYNFGL
|
8 | Penaeus monodon | Allatostatin | Allatostatin A | 21459120#Chansela P, Goto-Inoue N, Zaima N, Sroyraya M, Sobhon P, Setou M#Visualization of neuropeptides in paraffin-embedded tissue sections of the central nervous system in the decapod crustacean, Penaeus monodon, by imaging mass spectrometry#Peptides 2012 Mar;34(1):10-8 | |
NP00503 |
NWGQFHGGW
|
9 | Zophobas atratus | Allatostatin | Trica-MIP-4 | 21067424#Marciniak P, Audsley N, Kuczer M, Rosinski G#Identification of myotropic neuropeptides from the brain and corpus cardiacum-corpus allatum complex of the beetle, Zophobas atratus#J Insect Sci 2010;10:156 | |
NP00504 |
AYTYVSEY
|
8 | Apis mellifera | Allatostatin | Allatostatin-1 | 17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J., Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L., Robinson G.E., Sweedler J.V.; #From the genome to the proteome: uncovering peptides in the Apis brain.; #Science 314:647-649(2006). | |
NP00505 |
LPVYNFGI
|
8 | Apis mellifera | Allatostatin | Allatostatin-2a | 17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J., Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L., Robinson G.E., Sweedler J.V.; #From the genome to the proteome: uncovering peptides in the Apis brain.; #Science 314:647-649(2006). | |
NP00506 |
LPVYNF
|
6 | Apis mellifera | Allatostatin | Allatostatin-2b | 17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J., Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L., Robinson G.E., Sweedler J.V.; #From the genome to the proteome: uncovering peptides in the Apis brain.; #Science 314:647-649(2006). | |
NP00507 |
GRDYSFGL
|
8 | Apis mellifera | Allatostatin | Allatostatin-3 | 17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J., Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L., Robinson G.E., Sweedler J.V.; #From the genome to the proteome: uncovering peptides in the Apis brain.; #Science 314:647-649(2006). | |
NP00508 |
RQYSFGL
|
7 | Apis mellifera | Allatostatin | Allatostatin-4 | 17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J., Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L., Robinson G.E., Sweedler J.V.; #From the genome to the proteome: uncovering peptides in the Apis brain.; #Science 314:647-649(2006). | |
NP00509 |
NDNADYPLRLNLDYLPVDNPAFHSQENTDDFLEE
|
34 | Apis mellifera | Allatostatin | Allatostatin-5 | 17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J., Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L., Robinson G.E., Sweedler J.V.; #From the genome to the proteome: uncovering peptides in the Apis brain.; #Science 314:647-649(2006). | |
NP00510 |
GRQPYSFGL
|
9 | Apis mellifera | Allatostatin | Allatostatin-6 | 17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J., Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L., Robinson G.E., Sweedler J.V.; #From the genome to the proteome: uncovering peptides in the Apis brain.; #Science 314:647-649(2006). | |
NP00511 |
AVHYSGGQPLGSKRPNDMLSQRYHFGL
|
27 | Apis mellifera | Allatostatin | Allatostatin-7a | 17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J., Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L., Robinson G.E., Sweedler J.V.; #From the genome to the proteome: uncovering peptides in the Apis brain.; #Science 314:647-649(2006). | |
NP00512 |
AVHYSGGQPLGS
|
12 | Apis mellifera | Allatostatin | Allatostatin-7b | 17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J., Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L., Robinson G.E., Sweedler J.V.; #From the genome to the proteome: uncovering peptides in the Apis brain.; #Science 314:647-649(2006). | |
NP00513 |
PNDMLSQRYHFGL
|
13 | Apis mellifera | Allatostatin | Allatostatin-7c | 17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J., Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L., Robinson G.E., Sweedler J.V.; #From the genome to the proteome: uncovering peptides in the Apis brain.; #Science 314:647-649(2006). | |
NP00514 |
DPLNEERRANRYGFGL
|
16 | Calliphora vomitoria | Allatostatin | Callatostatin-1 | 8460157#Duve H., Johnsen A.H., Scott A.G., Yu C.G., Yagi K.J., Tobe S.S., Thorpe A.; #Callatostatins: neuropeptides from the blowfly Calliphora vomitoria with sequence homology to cockroach allatostatins.; #Proc. Natl. Acad. Sci. U.S.A. 90:2456-2460(1993). | |
NP00515 |
LNEERRANRYGFGL
|
14 | Calliphora vomitoria | Allatostatin | Callatostatin-2 | 8460157#Duve H., Johnsen A.H., Scott A.G., Yu C.G., Yagi K.J., Tobe S.S., Thorpe A.; #Callatostatins: neuropeptides from the blowfly Calliphora vomitoria with sequence homology to cockroach allatostatins.; #Proc. Natl. Acad. Sci. U.S.A. 90:2456-2460(1993). | |
NP00516 |
ANRYGFGL
|
8 | Calliphora vomitoria | Allatostatin | Callatostatin-3 | 8460157#Duve H., Johnsen A.H., Scott A.G., Yu C.G., Yagi K.J., Tobe S.S., Thorpe A.; #Callatostatins: neuropeptides from the blowfly Calliphora vomitoria with sequence homology to cockroach allatostatins.; #Proc. Natl. Acad. Sci. U.S.A. 90:2456-2460(1993). | |
NP00517 |
DRPYSFGL
|
8 | Calliphora vomitoria | Allatostatin | Callatostatin-4 | 8460157#Duve H., Johnsen A.H., Scott A.G., Yu C.G., Yagi K.J., Tobe S.S., Thorpe A.; #Callatostatins: neuropeptides from the blowfly Calliphora vomitoria with sequence homology to cockroach allatostatins.; #Proc. Natl. Acad. Sci. U.S.A. 90:2456-2460(1993). | |
NP00518 |
GPPYDFGM
|
8 | Calliphora vomitoria | Allatostatin | Callatostatin-5 | 8460157#Duve H., Johnsen A.H., Scott A.G., Yu C.G., Yagi K.J., Tobe S.S., Thorpe A.; #Callatostatins: neuropeptides from the blowfly Calliphora vomitoria with sequence homology to cockroach allatostatins.; #Proc. Natl. Acad. Sci. U.S.A. 90:2456-2460(1993). | |
NP00519 |
APQPYAFGL
|
9 | Carcinus maenas | Allatostatin | Carcinustatin-10 | 9461295#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Jaros P.P., Thorpe A.; #Isolation and identification of multiple neuropeptides of the allatostatin superfamily in the shore crab Carcinus maenas.; #Eur. J. Biochem. 250:727-734(1997). | |
NP00520 |
ATGQYAFGL
|
9 | Carcinus maenas | Allatostatin | Carcinustatin-11 | 9461295#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Jaros P.P., Thorpe A.; #Isolation and identification of multiple neuropeptides of the allatostatin superfamily in the shore crab Carcinus maenas.; #Eur. J. Biochem. 250:727-734(1997). | |
NP00521 |
PDMYAFGL
|
8 | Carcinus maenas | Allatostatin | Carcinustatin-12 | 9461295#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Jaros P.P., Thorpe A.; #Isolation and identification of multiple neuropeptides of the allatostatin superfamily in the shore crab Carcinus maenas.; #Eur. J. Biochem. 250:727-734(1997). | |
NP00522 |
EYDDMYTEKRPKVYAFGL
|
18 | Carcinus maenas | Allatostatin | Carcinustatin-13 | 9461295#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Jaros P.P., Thorpe A.; #Isolation and identification of multiple neuropeptides of the allatostatin superfamily in the shore crab Carcinus maenas.; #Eur. J. Biochem. 250:727-734(1997). | |
NP00523 |
YSFGL
|
5 | Carcinus maenas | Allatostatin | Carcinustatin-14 | 9461295#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Jaros P.P., Thorpe A.; #Isolation and identification of multiple neuropeptides of the allatostatin superfamily in the shore crab Carcinus maenas.; #Eur. J. Biochem. 250:727-734(1997). | |
NP00524 |
AGPYSFGL
|
8 | Carcinus maenas | Allatostatin | Carcinustatin-15 | 9461295#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Jaros P.P., Thorpe A.; #Isolation and identification of multiple neuropeptides of the allatostatin superfamily in the shore crab Carcinus maenas.; #Eur. J. Biochem. 250:727-734(1997). | |
NP00525 |
GGPYSYGL
|
8 | Carcinus maenas | Allatostatin | Carcinustatin-16 | 9461295#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Jaros P.P., Thorpe A.; #Isolation and identification of multiple neuropeptides of the allatostatin superfamily in the shore crab Carcinus maenas.; #Eur. J. Biochem. 250:727-734(1997). | |
NP00526 |
SGQYSFGL
|
8 | Carcinus maenas | Allatostatin | Carcinustatin-17 | 9461295#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Jaros P.P., Thorpe A.; #Isolation and identification of multiple neuropeptides of the allatostatin superfamily in the shore crab Carcinus maenas.; #Eur. J. Biochem. 250:727-734(1997). | |
NP00527 |
SDMYSFGL
|
8 | Carcinus maenas | Allatostatin | Carcinustatin-18 | 9461295#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Jaros P.P., Thorpe A.; #Isolation and identification of multiple neuropeptides of the allatostatin superfamily in the shore crab Carcinus maenas.; #Eur. J. Biochem. 250:727-734(1997). | |
NP00528 |
APTDMYSFGL
|
10 | Carcinus maenas | Allatostatin | Carcinustatin-19 | 9461295#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Jaros P.P., Thorpe A.; #Isolation and identification of multiple neuropeptides of the allatostatin superfamily in the shore crab Carcinus maenas.; #Eur. J. Biochem. 250:727-734(1997). | |
NP00529 |
EAYAFGL
|
7 | Carcinus maenas | Allatostatin | Carcinustatin-2 | 9461295#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Jaros P.P., Thorpe A.; #Isolation and identification of multiple neuropeptides of the allatostatin superfamily in the shore crab Carcinus maenas.; #Eur. J. Biochem. 250:727-734(1997). | |
NP00530 |
GYEDEDEDRPFYALGLGKRPRTYSFGL
|
27 | Carcinus maenas | Allatostatin | Carcinustatin-20 | 9461295#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Jaros P.P., Thorpe A.; #Isolation and identification of multiple neuropeptides of the allatostatin superfamily in the shore crab Carcinus maenas.; #Eur. J. Biochem. 250:727-734(1997). | |
NP00531 |
EPYAFGL
|
7 | Carcinus maenas | Allatostatin | Carcinustatin-3 | 9461295#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Jaros P.P., Thorpe A.; #Isolation and identification of multiple neuropeptides of the allatostatin superfamily in the shore crab Carcinus maenas.; #Eur. J. Biochem. 250:727-734(1997). | |
NP00532 |
DPYAFGL
|
7 | Carcinus maenas | Allatostatin | Carcinustatin-4 | 9461295#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Jaros P.P., Thorpe A.; #Isolation and identification of multiple neuropeptides of the allatostatin superfamily in the shore crab Carcinus maenas.; #Eur. J. Biochem. 250:727-734(1997). | |
NP00533 |
NPYAFGL
|
7 | Carcinus maenas | Allatostatin | Carcinustatin-5 | 9461295#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Jaros P.P., Thorpe A.; #Isolation and identification of multiple neuropeptides of the allatostatin superfamily in the shore crab Carcinus maenas.; #Eur. J. Biochem. 250:727-734(1997). | |
NP00534 |
YAFGL
|
5 | Carcinus maenas | Allatostatin | Carcinustatin-1 | 9461295#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Jaros P.P., Thorpe A.; #Isolation and identification of multiple neuropeptides of the allatostatin superfamily in the shore crab Carcinus maenas.; #Eur. J. Biochem. 250:727-734(1997). | |
NP00535 |
SPYAFGL
|
7 | Carcinus maenas | Allatostatin | Carcinustatin-6 | 9461295#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Jaros P.P., Thorpe A.; #Isolation and identification of multiple neuropeptides of the allatostatin superfamily in the shore crab Carcinus maenas.; #Eur. J. Biochem. 250:727-734(1997). | |
NP00536 |
ASPYAFGL
|
8 | Carcinus maenas | Allatostatin | Carcinustatin-7 | 9461295#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Jaros P.P., Thorpe A.; #Isolation and identification of multiple neuropeptides of the allatostatin superfamily in the shore crab Carcinus maenas.; #Eur. J. Biochem. 250:727-734(1997). | |
NP00537 |
AGPYAFGL
|
8 | Carcinus maenas | Allatostatin | Carcinustatin-8 | 9461295#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Jaros P.P., Thorpe A.; #Isolation and identification of multiple neuropeptides of the allatostatin superfamily in the shore crab Carcinus maenas.; #Eur. J. Biochem. 250:727-734(1997). | |
NP00538 |
GGPYAFGL
|
8 | Carcinus maenas | Allatostatin | Carcinustatin-9 | 9461295#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Jaros P.P., Thorpe A.; #Isolation and identification of multiple neuropeptides of the allatostatin superfamily in the shore crab Carcinus maenas.; #Eur. J. Biochem. 250:727-734(1997). | |
NP00539 |
SPHYNFGL
|
8 | Cydia pomonella | Allatostatin | Cydiastatin-1 | 9392829#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Winstanley D., Davey M., East P.D., Thorpe A.; #Lepidopteran peptides of the allatostatin superfamily.; #Peptides 18:1301-1309(1997). | |
NP00540 |
AYSYVSEYKRLPVYNFGL
|
18 | Cydia pomonella | Allatostatin | Cydiastatin-2 | 9392829#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Winstanley D., Davey M., East P.D., Thorpe A.; #Lepidopteran peptides of the allatostatin superfamily.; #Peptides 18:1301-1309(1997). | |
NP00541 |
SRPYSFGL
|
8 | Cydia pomonella | Allatostatin | Cydiastatin-3 | 9392829#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Winstanley D., Davey M., East P.D., Thorpe A.; #Lepidopteran peptides of the allatostatin superfamily.; #Peptides 18:1301-1309(1997). | |
NP00542 |
ARPYSFGL
|
8 | Cydia pomonella | Allatostatin | Cydiastatin-4 | 9392829#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Winstanley D., Davey M., East P.D., Thorpe A.; #Lepidopteran peptides of the allatostatin superfamily.; #Peptides 18:1301-1309(1997). | |
NP00543 |
ARGYDFGL
|
8 | Cydia pomonella | Allatostatin | Cydiastatin-5 | 9392829#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Winstanley D., Davey M., East P.D., Thorpe A.; #Lepidopteran peptides of the allatostatin superfamily.; #Peptides 18:1301-1309(1997). | |
NP00544 |
LPLYNFGL
|
8 | Cydia pomonella | Allatostatin | Cydiastatin-6 | 9392829#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Winstanley D., Davey M., East P.D., Thorpe A.; #Lepidopteran peptides of the allatostatin superfamily.; #Peptides 18:1301-1309(1997). | |
NP00545 |
KMYDFGL
|
7 | Cydia pomonella | Allatostatin | Cydiastatin-7 | 9392829#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Winstanley D., Davey M., East P.D., Thorpe A.; #Lepidopteran peptides of the allatostatin superfamily.; #Peptides 18:1301-1309(1997). | |
NP00546 |
ARPYSFGL
|
8 | Delia radicum | Allatostatin | Allatostatin-A1 | 20869420#Audsley N., Matthews H.J., Down R.E., Weaver R.J.; #Neuropeptides associated with the central nervous system of the cabbage root fly, Delia radicum (L).; #Peptides 32:434-440(2011).$22848525#Zoephel J., Reiher W., Rexer K.-H., Kahnt J., Wegener C.; #"Peptidomics of the agriculturally damaging larval stage of the cabbage root fly Delia radicum (Diptera: Anthomyiidae)."; #PLoS ONE 7:E41543-E41543(2012). | |
NP00547 |
NRPYSFGL
|
8 | Delia radicum | Allatostatin | Allatostatin-A2 | 20869420#Audsley N., Matthews H.J., Down R.E., Weaver R.J.; #Neuropeptides associated with the central nervous system of the cabbage root fly, Delia radicum (L).; #Peptides 32:434-440(2011).$22848525#Zoephel J., Reiher W., Rexer K.-H., Kahnt J., Wegener C.; #"Peptidomics of the agriculturally damaging larval stage of the cabbage root fly Delia radicum (Diptera: Anthomyiidae)."; #PLoS ONE 7:E41543-E41543(2012). | |
NP00548 |
VERYAFGL
|
8 | Delia radicum | Allatostatin | Allatostatin-A3 | 20869420#Audsley N., Matthews H.J., Down R.E., Weaver R.J.; #Neuropeptides associated with the central nervous system of the cabbage root fly, Delia radicum (L).; #Peptides 32:434-440(2011).$22848525#Zoephel J., Reiher W., Rexer K.-H., Kahnt J., Wegener C.; #"Peptidomics of the agriculturally damaging larval stage of the cabbage root fly Delia radicum (Diptera: Anthomyiidae)."; #PLoS ONE 7:E41543-E41543(2012). | |
NP00549 |
LPVYNFGL
|
8 | Delia radicum | Allatostatin | Allatostatin-A4 | 20869420#Audsley N., Matthews H.J., Down R.E., Weaver R.J.; #Neuropeptides associated with the central nervous system of the cabbage root fly, Delia radicum (L).; #Peptides 32:434-440(2011).$22848525#Zoephel J., Reiher W., Rexer K.-H., Kahnt J., Wegener C.; #"Peptidomics of the agriculturally damaging larval stage of the cabbage root fly Delia radicum (Diptera: Anthomyiidae)."; #PLoS ONE 7:E41543-E41543(2012). | |
NP00550 |
QVRYRQCYFNPISCF
|
15 | Delia radicum | Allatostatin | Allatostatin-C1 | 22848525#Zoephel J., Reiher W., Rexer K.-H., Kahnt J., Wegener C.; #Peptidomics of the agriculturally damaging larval stage of the cabbage root fly Delia radicum (Diptera: Anthomyiidae).; #PLoS ONE 7:E41543-E41543(2012). | |
NP00551 |
LYDFGL
|
6 | Diploptera punctata | Allatostatin | Allatostatin-1 | ||
NP00552 |
PVNSGRSSGSRFNFGL
|
16 | Diploptera punctata | Allatostatin | Allatostatin-10 | ||
NP00553 |
YPQEHRFSFGL
|
11 | Diploptera punctata | Allatostatin | Allatostatin-11 | ||
NP00554 |
PFNFGL
|
6 | Diploptera punctata | Allatostatin | Allatostatin-12 | ||
NP00555 |
IPMYDFGI
|
8 | Diploptera punctata | Allatostatin | Allatostatin-13 | ||
NP00556 |
AYSYVSEYKRLPVYNFGL
|
18 | Diploptera punctata | Allatostatin | Allatostatin-2 | 2006179#Pratt G.E., Farnsworth D.E., Fok K.F., Siegel N.R., McCormack A.L., Shabanowitz J., Hunt D.F., Feyereisen R.; #Identity of a second type of allatostatin from cockroach brains: an octadecapeptide amide with a tyrosine-rich address sequence.; #Proc. Natl. Acad. Sci. U.S.A. 88:2412-2416(1991). | |
NP00557 |
SKMYGFGL
|
8 | Diploptera punctata | Allatostatin | Allatostatin-3 | ||
NP00558 |
DGRMYSFGL
|
9 | Diploptera punctata | Allatostatin | Allatostatin-4 | ||
NP00559 |
DRLYSFGL
|
8 | Diploptera punctata | Allatostatin | Allatostatin-5 | 2762309#Woodhead A.P., Stay B., Seidel S.L., Khan M.A., Tobe S.S.; #Primary structure of four allatostatins: neuropeptide inhibitors of juvenile hormone synthesis.; #Proc. Natl. Acad. Sci. U.S.A. 86:5997-6001(1989). | |
NP00560 |
ARPYSFGL
|
8 | Diploptera punctata | Allatostatin | Allatostatin-6 | ||
NP00561 |
APSGAQRLYGFGL
|
13 | Diploptera punctata | Allatostatin | Allatostatin-7 | 2762309# Woodhead A.P., Stay B., Seidel S.L., Khan M.A., Tobe S.S.; #Primary structure of four allatostatins: neuropeptide inhibitors of juvenile hormone synthesis.; # Proc. Natl. Acad. Sci. U.S.A. 86:5997-6001(1989).$2783135#Pratt G.E., Farnsworth D.E., Siegel N.R., Fok K.F., Feyereisen R.; #Identification of an allatostatin from adult Diploptera punctata.; #Biochem. Biophys. Res. Commun. 163:1243-1247(1989). | |
NP00562 |
GGSLYSFGL
|
9 | Diploptera punctata | Allatostatin | Allatostatin-8 | 2762309#Woodhead A.P., Stay B., Seidel S.L., Khan M.A., Tobe S.S.; #Primary structure of four allatostatins: neuropeptide inhibitors of juvenile hormone synthesis.; #Proc. Natl. Acad. Sci. U.S.A. 86:5997-6001(1989). | |
NP00563 |
GDGRLYAFGL
|
10 | Diploptera punctata | Allatostatin | Allatostatin-9 | 2762309#Woodhead A.P., Stay B., Seidel S.L., Khan M.A., Tobe S.S.; #Primary structure of four allatostatins: neuropeptide inhibitors of juvenile hormone synthesis.; #Proc. Natl. Acad. Sci. U.S.A. 86:5997-6001(1989). | |
NP00564 |
VERYAFGL
|
8 | Drosophila melanogaster | Allatostatin | Drostatin-1 (Potential) | ||
NP00565 |
LPVYNFGL
|
8 | Drosophila melanogaster | Allatostatin | Drostatin-2 (Potential) | ||
NP00566 |
SRPYSFGL
|
8 | Drosophila melanogaster | Allatostatin | Drostatin-3 | 12171930#Baggerman G., Cerstiaens A., De Loof A., Schoofs L.; #Peptidomics of the larval Drosophila melanogaster central nervous system.; #J. Biol. Chem. 277:40368-40374(2002). | |
NP00567 |
TTRPQPFNFGL
|
11 | Drosophila melanogaster | Allatostatin | Drostatin-4 | 12171930#Baggerman G., Cerstiaens A., De Loof A., Schoofs L.; #Peptidomics of the larval Drosophila melanogaster central nervous system.; #J. Biol. Chem. 277:40368-40374(2002). | |
NP00568 |
AYMYTNGGPGM
|
11 | Drosophila melanogaster | Allatostatin | Drostatin-5 | 12171930#Baggerman G., Cerstiaens A., De Loof A., Schoofs L.; #Peptidomics of the larval Drosophila melanogaster central nervous system.; #J. Biol. Chem. 277:40368-40374(2002). | |
NP00569 |
AWQSLQSSW
|
9 | Drosophila melanogaster | Allatostatin | Drostatin-B1 (Potential) | ||
NP00570 |
AWKSMNVAW
|
9 | Drosophila melanogaster | Allatostatin | Drostatin-B2 | 12171930#Baggerman G., Cerstiaens A., De Loof A., Schoofs L.; #Peptidomics of the larval Drosophila melanogaster central nervous system.; #J. Biol. Chem. 277:40368-40374(2002). | |
NP00571 |
RQAQGWNKFRGAW
|
13 | Drosophila melanogaster | Allatostatin | Drostatin-B3 (Potential) | 20575072#Carlsson MA, Diesner M, Schachtner J, Nässel DR#Multiple neuropeptides in the Drosophila antennal lobe suggest complex modulatory circuits#J Comp Neurol 2010 Aug 15;518(16):3359-80 | |
NP00572 |
EPTWNNLKGMW
|
11 | Drosophila melanogaster | Allatostatin | Drostatin-B4 (Potential) | ||
NP00573 |
DQWQKLHGGW
|
10 | Drosophila melanogaster | Allatostatin | Drostatin-B5 | 12171930#Baggerman G., Cerstiaens A., De Loof A., Schoofs L.; #Peptidomics of the larval Drosophila melanogaster central nervous system.; #J. Biol. Chem. 277:40368-40374(2002).$20575072#Carlsson MA, Diesner M, Schachtner J, Nässel DR#Multiple neuropeptides in the Drosophila antennal lobe suggest complex modulatory circuits#J Comp Neurol 2010 Aug 15;518(16):3359-80 | |
NP00574 |
SPHYDFGL
|
8 | Helicoverpa armigera | Allatostatin | Helicostatin-1 | 9392829#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Winstanley D., Davey M., East P.D., Thorpe A.; #Lepidopteran peptides of the allatostatin superfamily.; #Peptides 18:1301-1309(1997). | |
NP00575 |
AYSYVSEYKRLPVYNFGL
|
18 | Helicoverpa armigera | Allatostatin | Helicostatin-2a | 9392829#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Winstanley D., Davey M., East P.D., Thorpe A.; #Lepidopteran peptides of the allatostatin superfamily.; #Peptides 18:1301-1309(1997). | |
NP00576 |
LPVYNFGL
|
8 | Helicoverpa armigera | Allatostatin | Helicostatin-2b | ||
NP00577 |
SRPYSFGL
|
8 | Helicoverpa armigera | Allatostatin | Helicostatin-3 | 9392829#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Winstanley D., Davey M., East P.D., Thorpe A.; #Lepidopteran peptides of the allatostatin superfamily.; #Peptides 18:1301-1309(1997). | |
NP00578 |
ARPYSFGL
|
8 | Helicoverpa armigera | Allatostatin | Helicostatin-4 | 9392829#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Winstanley D., Davey M., East P.D., Thorpe A.; #Lepidopteran peptides of the allatostatin superfamily.; #Peptides 18:1301-1309(1997). | |
NP00579 |
ARAYDFGL
|
8 | Helicoverpa armigera | Allatostatin | Helicostatin-5 | 9392829#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Winstanley D., Davey M., East P.D., Thorpe A.; #Lepidopteran peptides of the allatostatin superfamily.; #Peptides 18:1301-1309(1997). | |
NP00580 |
LPMYNFGL
|
8 | Helicoverpa armigera | Allatostatin | Helicostatin-6 | 9392829#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Winstanley D., Davey M., East P.D., Thorpe A.; #Lepidopteran peptides of the allatostatin superfamily.; #Peptides 18:1301-1309(1997). | |
NP00581 |
ARSYNFGL
|
8 | Helicoverpa armigera | Allatostatin | Helicostatin-7 | 9392829#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Winstanley D., Davey M., East P.D., Thorpe A.; #Lepidopteran peptides of the allatostatin superfamily.; #Peptides 18:1301-1309(1997). | |
NP00582 |
YSKFNFGL
|
8 | Helicoverpa armigera | Allatostatin | Helicostatin-8 | 9392829#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Winstanley D., Davey M., East P.D., Thorpe A.; #Lepidopteran peptides of the allatostatin superfamily.; #Peptides 18:1301-1309(1997). | |
NP00583 |
ERDMHRFSFGL
|
11 | Helicoverpa armigera | Allatostatin | Helicostatin-9 | 9392829#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Winstanley D., Davey M., East P.D., Thorpe A.; #Lepidopteran peptides of the allatostatin superfamily.; #Peptides 18:1301-1309(1997). | |
NP00584 |
AWQDLNAGW
|
9 | Locusta migratoria | Allatostatin | Locustamyoinhibiting peptide | 1796179#Schoofs L., Holman G.M., Hayes T.K., Nachman R.J., de Loof A.; #Isolation, identification and synthesis of locustamyoinhibiting peptide (LOM-MIP), a novel biologically active neuropeptide from Locusta migratoria.; #Regul. Pept. 36:111-119(1991). | |
NP00585 |
QVRFRQCYFNPISCF
|
15 | Manduca sexta | Allatostatin | Allatostatin | 1946359#Kramer S.J., Toschi A., Miller C.A., Kataoka H., Quistad G.B., Li J.P., Carney R.L., Schooley D.A.; #Identification of an allatostatin from the tobacco hornworm Manduca sexta.; #Proc. Natl. Acad. Sci. U.S.A. 88:9458-9462(1991). | |
NP00586 |
LPVYNFGL
|
8 | Rhodnius prolixus | Allatostatin | Allatostatin-1 | 19137558#Ons S., Richter F., Urlaub H., Pomar R.R.; #The neuropeptidome of Rhodnius prolixus brain.; #Proteomics 9:788-792(2009). | |
NP00587 |
MRNYSFGL
|
8 | Rhodnius prolixus | Allatostatin | Allatostatin-2 | 19137558#Ons S., Richter F., Urlaub H., Pomar R.R.; #The neuropeptidome of Rhodnius prolixus brain.; #Proteomics 9:788-792(2009). | |
NP00588 |
QVSLKYPEGKMYSFGL
|
16 | Rhodnius prolixus | Allatostatin | Allatostatin-3 | 19137558#Ons S., Richter F., Urlaub H., Pomar R.R.; #The neuropeptidome of Rhodnius prolixus brain.; #Proteomics 9:788-792(2009). | |
NP00589 |
QVRFRQCYFNPISCF
|
15 | Spodoptera frugiperda | Allatostatin | Allatostatin (By similarity) | ||
NP00590 |
SYWKQCAFNAVSCF
|
14 | Apis mellifera | Allatostatin | Allatostatin C | 19576913#Boerjan B, Cardoen D, Bogaerts A, Landuyt B, Schoofs L, Verleyen P#Mass spectrometric profiling of (neuro)-peptides in the worker honeybee, Apis mellifera#Neuropharmacology 2010 Jan;58(1):248-58 $17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J.,Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L.,Robinson G.E., Sweedler J.V.#From the genome to the proteome: uncovering peptides in the Apis brain.#Science 314:647-649(2006). | |
NP00591 |
LRNQLDIGDL
|
10 | Apis mellifera | Allatostatin | LRNQLDIGDLQ–allatostatinC | 19576913#Boerjan B, Cardoen D, Bogaerts A, Landuyt B, Schoofs L, Verleyen P#Mass spectrometric profiling of (neuro)-peptides in the worker honeybee, Apis mellifera#Neuropharmacology 2010 Jan;58(1):248-58 $17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J.,Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L.,Robinson G.E., Sweedler J.V.#From the genome to the proteome: uncovering peptides in the Apis brain.#Science 314:647-649(2006). | |
NP00592 |
LRNQLDIGDLQ
|
11 | Apis mellifera | Allatostatin | LRNQLDIGDLQ–allatostatinC | 19576913#Boerjan B, Cardoen D, Bogaerts A, Landuyt B, Schoofs L, Verleyen P#Mass spectrometric profiling of (neuro)-peptides in the worker honeybee, Apis mellifera#Neuropharmacology 2010 Jan;58(1):248-58 $17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J.,Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L.,Robinson G.E., Sweedler J.V.#From the genome to the proteome: uncovering peptides in the Apis brain.#Science 314:647-649(2006). | |
NP00593 |
AQHQYSFGL
|
9 | Gryllus bimaculatus | Allatostatin | Allatostatin 1 | 7673141#Lorenz MW, Kellner R, Hoffmann KH#A family of neuropeptides that inhibit juvenile hormone biosynthesis in the cricket, Gryllus bimaculatus#J Biol Chem 1995 Sep 8;270(36):21103-8 | |
NP00594 |
AGGRQYGFGL
|
10 | Gryllus bimaculatus | Allatostatin | Allatostatin-2 | 7673141#Lorenz MW, Kellner R, Hoffmann KH#A family of neuropeptides that inhibit juvenile hormone biosynthesis in the cricket, Gryllus bimaculatus#J Biol Chem 1995 Sep 8;270(36):21103-8 | |
NP00595 |
NYWRQCAFNAVSCF
|
14 | Nasonia vitripennis | Allatostatin | Allatostatin-C | 20695486#Hauser F, Neupert S, Williamson M, Predel R, Tanaka Y, Grimmelikhuijzen CJ#Genomics and peptidomics of neuropeptides and protein hormones present in the parasitic wasp Nasonia vitripennis#J Proteome Res 2010 Oct 1;9(10):5296-310 | |
NP00596 |
GQAKGRVYWRCYFNAVTCF
|
19 | Nasonia vitripennis | Allatostatin | Allatostatin-CC | 20695486#Hauser F, Neupert S, Williamson M, Predel R, Tanaka Y, Grimmelikhuijzen CJ#Genomics and peptidomics of neuropeptides and protein hormones present in the parasitic wasp Nasonia vitripennis#J Proteome Res 2010 Oct 1;9(10):5296-310 |