Total number of results for Allatostatin are 361
Download
as Fasta All
| NPID | Sequence | Length | Organism | Family | Name | PMID | Peptide_REF |
|---|---|---|---|---|---|---|---|
| NP00236 | SRPYSFGL |
8 | Aedes aegypti | Allatostatin | Allatostatin | 9357049#Veenstra JA, Noriega FG, Graf R, Feyereisen R#Identification of three allatostatins and their cDNA from the mosquito Aedes aegypti#Peptides 1997;18(7):937-42 | |
| NP00237 | GEGKMFWRCYFNAVSCF |
17 | Amblyomma variegatum | Allatostatin | Allatostatin CC peptide | 20888826#Christie AE, Nolan DH, Ohno P, Hartline N, Lenz PH#Identification of chelicerate neuropeptides using bioinformatics of publicly accessible expressed sequence tags#Gen Comp Endocrinol 2011 Jan 1;170(1):144-55 | |
| NP00238 | GDGRLYAFGL |
10 | Ascaris suum | Allatostatin | Allatostatin A | 16185693#Mousley A, Moffett CL, Duve H, Thorpe A, Halton DW, Geary TG, Thompson DP, Maule AG, Marks NJ#Expression and bioactivity of allatostatin-like neuropeptides in helminths#Int J Parasitol 2005 Dec;35(14):1557-67 | |
| NP00239 | LYDFGL |
6 | Blattella germanica | Allatostatin | Allatostatin-1 | 7846299#Bellés X, Maestro JL, Piulachs MD, Johnsen AH, Duve H, Thorpe A#Allatostatic neuropeptides from the cockroach Blattella germanica (L#) (Dictyoptera, Blattellidae) Identification, immunolocalization and activity Regul Pept 1994 Oct 21;53(3):237-47 | |
| NP00240 | DRLYSFGL |
8 | Blattella germanica | Allatostatin | BLAST-2 | 9474781#Piulachs MD, Vilaplana L, Bartolomé JM, Carreño C, Martín D, González-Muñiz R, Herranz R, García-López MT, Andreu D, Bellés X#Ketomethylene and methyleneamino pseudopeptide analogues of insect allatostatins inhibit juvenile hormone and vitellogenin production in the cockroach Blattella germanica#Insect Biochem Mol Biol 1997 Oct;27(10):851-8 | |
| NP00241 | AGSDGRLYSFGL |
12 | Blattella germanica | Allatostatin | BLAST-3 | 7846299#Bellés X, Maestro JL, Piulachs MD, Johnsen AH, Duve H, Thorpe A#Allatostatic neuropeptides from the cockroach Blattella germanica (L) (Dictyoptera, Blattellidae) Identification, immunolocalization and activity #Regul Pept 1994 Oct 21;53(3):237-47 | |
| NP00242 | APSSAQRLYGFGL |
13 | Blattella germanica | Allatostatin | BLAST-4 | 7846299#Bellés X, Maestro JL, Piulachs MD, Johnsen AH, Duve H, Thorpe A#Allatostatic neuropeptides from the cockroach Blattella germanica (L#) (Dictyoptera, Blattellidae) Identification, immunolocalization and activity Regul Pept 1994 Oct 21;53(3):237-47 | |
| NP00243 | APYGFGI |
7 | Calanus finmarchicus | Allatostatin | Allatostatin A | 17950732#Christie AE, Sousa GL, Rus S, Smith CM, Towle DW, Hartline DK, Dickinson PS#Identification of A-type allatostatins possessing -YXFGI/Vamide carboxy-termini from the nervous system of the copepod crustacean Calanus finmarchicus#Gen Comp Endocrinol 2008 Feb 1;155(3):526-33 | |
| NP00244 | EPYGFGI |
7 | Calanus finmarchicus | Allatostatin | Allatostatin A | 17950732#Christie AE, Sousa GL, Rus S, Smith CM, Towle DW, Hartline DK, Dickinson PS#Identification of A-type allatostatins possessing -YXFGI/Vamide carboxy-termini from the nervous system of the copepod crustacean Calanus finmarchicus#Gen Comp Endocrinol 2008 Feb 1;155(3):526-33 | |
| NP00245 | GPXYDFGM |
8 | Calliphora vomitoria | Allatostatin | [HYP3]Met-callatostatin | 8063725#Duve H, Johnsen AH, Scott AG, East P, Thorpe A#[Hyp3]Met-callatostatin#Identification and biological properties of a novel neuropeptide from the blowfly Calliphora vomitoria J Biol Chem 1994 Aug 19;269(33):21059-66 | |
| NP00246 | XRPYSFGL |
8 | Calliphora vomitoria | Allatostatin | Callatostatin 4 | 8460157#Duve H, Johnsen AH, Scott AG, Yu CG, Yagi KJ, Tobe SS, Thorpe A#Callatostatins: neuropeptides from the blowfly Calliphora vomitoria with sequence homology to cockroach allatostatins#Proc Natl Acad Sci U S A 1993 Mar 15;90(6):2456-60 | |
| NP00247 | LPVYNFGL |
8 | Calliphora vomitoria | Allatostatin | Leu-callatostatin | 8952000#Duve H, Johnsen AH, Maestro JL, Scott AG, East PD, Thorpe A#Identification of the dipteran Leu-callatostatin peptide family: the pattern of precursor processing revealed by isolation studies in Calliphora vomitoria#Regul Pept 1996 Nov 14;67(1):11-9 | |
| NP00248 | NRPYSFGL |
8 | Calliphora vomitoria | Allatostatin | Leu-callatostatin | 8952000#Duve H, Johnsen AH, Maestro JL, Scott AG, East PD, Thorpe A#Identification of the dipteran Leu-callatostatin peptide family: the pattern of precursor processing revealed by isolation studies in Calliphora vomitoria#Regul Pept 1996 Nov 14;67(1):11-9 | |
| NP00249 | PYDFGM |
6 | Calliphora vomitoria | Allatostatin | Met-callatostatin | 7480873#Duve H, Johnsen AH, Scott AG, Thorpe A#Isolation, identification and functional significance of [Hyp2]Met-callatostatin and des Gly-Pro Met-callatostatin, two further post-translational modifications of the blowfly neuropeptide Met-callatostatin#Regul Pept 1995 Jun 27;57(3):237-45 | |
| NP00250 | QIRYHQCYFNPISCF |
15 | Cancer borealis | Allatostatin | Allatostatin C | 19505516#Ma M, Szabo TM, Jia C, Marder E, Li L#Mass spectrometric characterization and physiological actions of novel crustacean C-type allatostatins#Peptides 2009 Sep;30(9):1660-8 | |
| NP00251 | SYWKQCAFNAVSCF |
14 | Cancer borealis | Allatostatin | Allatostatin C | 19505516#Ma M, Szabo TM, Jia C, Marder E, Li L#Mass spectrometric characterization and physiological actions of novel crustacean C-type allatostatins#Peptides 2009 Sep;30(9):1660-8 | |
| NP00252 | LPVYNFGL |
8 | Cydia pomonella | Allatostatin | Leu-callatostatin | 9182602#Duve H, Johnsen AH, Maestro JL, Scott AG, Crook N, Winstanley D, Thorpe A#Identification, tissue localisation and physiological effect in vitro of a neuroendocrine peptide identical to a dipteran Leu-callatostatin in the codling moth Cydia pomonella (Tortricidae: Lepidoptera)#Cell Tissue Res 1997 Jul;289(1):73-83 | |
| NP00253 | EVRYRQCYFNPISCF |
15 | Drosophila melanogaster | Allatostatin | Allatostatin C | 12479379#Kaminski S, Orlowski E, Berry K, Nichols R#The effects of three Drosophila melanogaster myotropins on the frequency of foregut contractions differ#J Neurogenet 2002 Apr-Jun;16(2):125-34 | |
| NP00254 | GEGKMFWRCYFNAVSCF |
17 | Mesobuthus gibbosus | Allatostatin | Allatostatin CC peptide | 20888826#Christie AE, Nolan DH, Ohno P, Hartline N, Lenz PH#Identification of chelicerate neuropeptides using bioinformatics of publicly accessible expressed sequence tags#Gen Comp Endocrinol 2011 Jan 1;170(1):144-55 | |
| NP00255 | PRVYGFGL |
8 | Orconectes limosus | Allatostatin | Allatostatin A | 10477125#Dircksen H, Skiebe P, Abel B, Agricola H, Buchner K, Muren JE, Nässel DR#Structure, distribution, and biological activity of novel members of the allatostatin family in the crayfish Orconectes limosus#Peptides 1999;20(6):695-712 | |
| NP00256 | AGPYAFGL |
8 | Orconectes limosus | Allatostatin | Carcinustatin-8 | 10477125#Dircksen H, Skiebe P, Abel B, Agricola H, Buchner K, Muren JE, Nässel DR#Structure, distribution, and biological activity of novel members of the allatostatin family in the crayfish Orconectes limosus#Peptides 1999;20(6):695-712 | |
| NP00257 | SAGPYAFGL |
9 | Orconectes limosus | Allatostatin | orcostatin I | 10477125#Dircksen H, Skiebe P, Abel B, Agricola H, Buchner K, Muren JE, Nässel DR#Structure, distribution, and biological activity of novel members of the allatostatin family in the crayfish Orconectes limosus#Peptides 1999;20(6):695-712 | |
| NP00258 | ANQYTFGL |
8 | Penaeus monodon | Allatostatin | Allatostatin | 12126730#Duve H, Johnsen AH, Scott AG, Thorpe A#Allatostatins of the tiger prawn, Penaeus monodon (Crustacea: Penaeidea)#Peptides 2002 Jun;23(6):1039-51 | |
| NP00259 | ASQYTFGL |
8 | Penaeus monodon | Allatostatin | Allatostatin | 12126730#Duve H, Johnsen AH, Scott AG, Thorpe A#Allatostatins of the tiger prawn, Penaeus monodon (Crustacea: Penaeidea)#Peptides 2002 Jun;23(6):1039-51 | |
| NP00260 | ATGAASLYSFGL |
12 | Schistocerca gregaria | Allatostatin | Allatostatin 3 | 8902848#Veelaert D, Devreese B, Schoofs L, Van Beeumen J, Vanden Broeck J, Tobe SS, De Loof A#Isolation and characterization of eight myoinhibiting peptides from the desert locust, Schistocerca gregaria: new members of the cockroach allatostatin family#Mol Cell Endocrinol 1996 Sep 18;122(2):183-90 | |
| NP00261 | AYTYVSEYKRLPVYNFGL |
18 | Schistocerca gregaria | Allatostatin | Allatostatin-2 | 8902848#Veelaert D, Devreese B, Schoofs L, Van Beeumen J, Vanden Broeck J, Tobe SS, De Loof A#Isolation and characterization of eight myoinhibiting peptides from the desert locust, Schistocerca gregaria: new members of the cockroach allatostatin family#Mol Cell Endocrinol 1996 Sep 18;122(2):183-90 | |
| NP00262 | ARPYSFGL |
8 | Schistocerca gregaria | Allatostatin | Allatostatin-6 | 8902848#Veelaert D, Devreese B, Schoofs L, Van Beeumen J, Vanden Broeck J, Tobe SS, De Loof A#Isolation and characterization of eight myoinhibiting peptides from the desert locust, Schistocerca gregaria: new members of the cockroach allatostatin family#Mol Cell Endocrinol 1996 Sep 18;122(2):183-90 | |
| NP00263 | APAEHRFSFGL |
11 | Schistocerca gregaria | Allatostatin | Scg-AST-10 | 8902848#Veelaert D, Devreese B, Schoofs L, Van Beeumen J, Vanden Broeck J, Tobe SS, De Loof A#Isolation and characterization of eight myoinhibiting peptides from the desert locust, Schistocerca gregaria: new members of the cockroach allatostatin family#Mol Cell Endocrinol 1996 Sep 18;122(2):183-90 | |
| NP00264 | GPRTYSFGL |
9 | Schistocerca gregaria | Allatostatin | Scg-AST-4 | 8902848#Veelaert D, Devreese B, Schoofs L, Van Beeumen J, Vanden Broeck J, Tobe SS, De Loof A#Isolation and characterization of eight myoinhibiting peptides from the desert locust, Schistocerca gregaria: new members of the cockroach allatostatin family#Mol Cell Endocrinol 1996 Sep 18;122(2):183-90 | |
| NP00265 | GRLYSFGL |
8 | Schistocerca gregaria | Allatostatin | Scg-AST-5 | 8902848#Veelaert D, Devreese B, Schoofs L, Van Beeumen J, Vanden Broeck J, Tobe SS, De Loof A#Isolation and characterization of eight myoinhibiting peptides from the desert locust, Schistocerca gregaria: new members of the cockroach allatostatin family#Mol Cell Endocrinol 1996 Sep 18;122(2):183-90 | |
| NP00266 | AGPAPSRLYSFGL |
13 | Schistocerca gregaria | Allatostatin | Scg-AST-7 | 8902848#Veelaert D, Devreese B, Schoofs L, Van Beeumen J, Vanden Broeck J, Tobe SS, De Loof A#Isolation and characterization of eight myoinhibiting peptides from the desert locust, Schistocerca gregaria: new members of the cockroach allatostatin family#Mol Cell Endocrinol 1996 Sep 18;122(2):183-90 | |
| NP00267 | EGRMYSFGL |
9 | Schistocerca gregaria | Allatostatin | Scg-AST-8 | 8902848#Veelaert D, Devreese B, Schoofs L, Van Beeumen J, Vanden Broeck J, Tobe SS, De Loof A#Isolation and characterization of eight myoinhibiting peptides from the desert locust, Schistocerca gregaria: new members of the cockroach allatostatin family#Mol Cell Endocrinol 1996 Sep 18;122(2):183-90 | |
| NP00268 | ESRYRQCYFNPISCF |
15 | Tenebrio molitor | Allatostatin | Allatostatin-C | 18201799#Weaver RJ, Audsley N#Neuropeptides of the beetle, Tenebrio molitor identified using MALDI-TOF mass spectrometry and deduced sequences from the Tribolium castaneum genome#Peptides 2008 Feb;29(2):168-78 | |
| NP00269 | QIRYHQCYFNPISCF |
15 | Tetranychus urticae | Allatostatin | Allatostatin C | 20888826#Christie AE, Nolan DH, Ohno P, Hartline N, Lenz PH#Identification of chelicerate neuropeptides using bioinformatics of publicly accessible expressed sequence tags#Gen Comp Endocrinol 2011 Jan 1;170(1):144-55 | |
| NP00270 | SPKYNFGL |
8 | Aedes aegypti | Allatostatin | Allatostatin 1 | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
| NP00271 | LPHYNFGL |
8 | Aedes aegypti | Allatostatin | Allatostatin 2 | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
| NP00272 | ASAYRYHFGL |
10 | Aedes aegypti | Allatostatin | Allatostatin 3 | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
| NP00273 | QIRYRQCYFNPISCF |
15 | Aedes aegypti | Allatostatin | Allatostatin C | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
| NP00274 | RVYDFGL |
7 | Aedes aegypti | Allatostatin | Allatostatin-4 | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
| NP00275 | LPNRYNFGL |
9 | Aedes aegypti | Allatostatin | Allatostatin-5 | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
| NP00276 | VYEDKRLPNRYNFGL |
15 | Aedes aegypti | Allatostatin | AST-5 | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
| NP00277 | TWKNLQGGW |
9 | Aedes aegypti | Allatostatin | MIP-1 | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
| NP00278 | AWNKINGGW |
9 | Aedes aegypti | Allatostatin | MIP-2 | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
| NP00279 | VNAGPAQWNKFRGSW |
15 | Aedes aegypti | Allatostatin | MIP-3 | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
| NP00280 | EPGWNNLKGLW |
11 | Aedes aegypti | Allatostatin | MIP-4b | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
| NP00281 | SEKWNKLSSSW |
11 | Aedes aegypti | Allatostatin | MIP-5 | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
| NP00282 | AYTYVSEYKRLPVYNFGI |
18 | Apis mellifera | Allatostatin | Allatostatin A | 19576913#Boerjan B, Cardoen D, Bogaerts A, Landuyt B, Schoofs L, Verleyen P#Mass spectrometric profiling of (neuro)-peptides in the worker honeybee, Apis mellifera#Neuropharmacology 2010 Jan;58(1):248-58 | |
| NP00283 | AAGLQNYDFG |
10 | Callinectes sapidus | Allatostatin | Allatostatin A | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
| NP00284 | AGLSALYSFG |
10 | Callinectes sapidus | Allatostatin | Allatostatin A | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
| NP00285 | AGPYSFGL |
8 | Callinectes sapidus | Allatostatin | Allatostatin A | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
| NP00286 | ALTTLYAFGL |
10 | Callinectes sapidus | Allatostatin | Allatostatin A | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
| NP00287 | APQPYAFGL |
9 | Callinectes sapidus | Allatostatin | Allatostatin A | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
| NP00288 | APRPYSFGL |
9 | Callinectes sapidus | Allatostatin | Allatostatin A | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
| NP00289 | ARAYDFGL |
8 | Callinectes sapidus | Allatostatin | Allatostatin A | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
| NP00290 | ARGYDFGL |
8 | Callinectes sapidus | Allatostatin | Allatostatin A | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
| NP00291 | ARPYSFGL |
8 | Callinectes sapidus | Allatostatin | Allatostatin A | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
| NP00292 | ASPYAFGL |
8 | Callinectes sapidus | Allatostatin | Allatostatin A | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
| NP00293 | DGPYSFGL |
8 | Callinectes sapidus | Allatostatin | Allatostatin A | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
| NP00294 | DPYAFGL |
7 | Callinectes sapidus | Allatostatin | Allatostatin A | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
| NP00295 | ERAYSFGL |
8 | Callinectes sapidus | Allatostatin | Allatostatin A | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
| NP00296 | FSGTYNFGL |
9 | Callinectes sapidus | Allatostatin | Allatostatin A | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
| NP00297 | GPPYSFGL |
8 | Callinectes sapidus | Allatostatin | Allatostatin A | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
| NP00298 | GPYSFGL |
7 | Callinectes sapidus | Allatostatin | Allatostatin A | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
| NP00299 | GSGQYAYGLGKAGQYSFGL |
19 | Callinectes sapidus | Allatostatin | Allatostatin A | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
| NP00300 | NGSYPFGL |
8 | Callinectes sapidus | Allatostatin | Allatostatin A | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
| NP00301 | NPYSFGL |
7 | Callinectes sapidus | Allatostatin | Allatostatin A | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
| NP00302 | NVYSFGL |
7 | Callinectes sapidus | Allatostatin | Allatostatin A | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
| NP00303 | PRVYSFGL |
8 | Callinectes sapidus | Allatostatin | Allatostatin A | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
| NP00304 | QWLYSMFGL |
9 | Callinectes sapidus | Allatostatin | Allatostatin A | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
| NP00305 | RNMYSFGL |
8 | Callinectes sapidus | Allatostatin | Allatostatin A | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
| NP00306 | SDMYSFGL |
8 | Callinectes sapidus | Allatostatin | Allatostatin A | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
| NP00307 | SGHYNFGL |
8 | Callinectes sapidus | Allatostatin | Allatostatin A | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
| NP00308 | SGNYNFGL |
8 | Callinectes sapidus | Allatostatin | Allatostatin A | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
| NP00309 | SNPYSFGL |
8 | Callinectes sapidus | Allatostatin | Allatostatin A | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
| NP00310 | SSGQYAFGL |
9 | Callinectes sapidus | Allatostatin | Allatostatin A | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
| NP00311 | TAPYAFGL |
8 | Callinectes sapidus | Allatostatin | Allatostatin A | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
| NP00312 | THPTYSFGL |
9 | Callinectes sapidus | Allatostatin | Allatostatin A | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
| NP00313 | TPQANSFGL |
9 | Callinectes sapidus | Allatostatin | Allatostatin A | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
| NP00314 | TRPYSFGL |
8 | Callinectes sapidus | Allatostatin | Allatostatin A | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
| NP00315 | YAFGL |
5 | Callinectes sapidus | Allatostatin | Allatostatin A | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
| NP00316 | AGWNKFQGSW |
10 | Callinectes sapidus | Allatostatin | Allatostatin B | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
| NP00317 | AGWSSLKGAW |
10 | Callinectes sapidus | Allatostatin | Allatostatin B | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
| NP00318 | AGWSSMRGAW |
10 | Callinectes sapidus | Allatostatin | Allatostatin B | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
| NP00319 | AWSNLQGAW |
9 | Callinectes sapidus | Allatostatin | Allatostatin B | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
| NP00320 | GNWNKFQGSW |
10 | Callinectes sapidus | Allatostatin | Allatostatin B | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
| NP00321 | NDWSKFGQSW |
10 | Callinectes sapidus | Allatostatin | Allatostatin B | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
| NP00322 | NNNWSKFQGSW |
11 | Callinectes sapidus | Allatostatin | Allatostatin B | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
| NP00323 | NNNWTKFQGSW |
11 | Callinectes sapidus | Allatostatin | Allatostatin B | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
| NP00324 | NNWSKFQGSW |
10 | Callinectes sapidus | Allatostatin | Allatostatin B | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
| NP00325 | NWNKFQGSW |
9 | Callinectes sapidus | Allatostatin | Allatostatin B | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
| NP00326 | SGDWSSLRGAW |
11 | Callinectes sapidus | Allatostatin | Allatostatin B | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
| NP00327 | SGKWSNLRGAW |
11 | Callinectes sapidus | Allatostatin | Allatostatin B | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
| NP00328 | STDWSSLRSAW |
11 | Callinectes sapidus | Allatostatin | Allatostatin B | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
| NP00329 | STNWSSLRSAW |
11 | Callinectes sapidus | Allatostatin | Allatostatin B | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
| NP00330 | TGWNKFQGSW |
10 | Callinectes sapidus | Allatostatin | Allatostatin B | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
| NP00331 | TSWGKFQGSW |
10 | Callinectes sapidus | Allatostatin | Allatostatin B | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
| NP00332 | VPNDWAHFRGSW |
12 | Callinectes sapidus | Allatostatin | Allatostatin B | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
| NP00333 | DPYAFGL |
7 | Cancer borealis | Allatostatin | Allatostatin A | 18700782#Behrens HL, Chen R, Li L#Combining microdialysis, NanoLC-MS, and MALDI-TOF/TOF to detect neuropeptides secreted in the crab, Cancer borealis#Anal Chem 2008 Sep 15;80(18):6949-58 | |
| NP00334 | ERAYSFGL |
8 | Cancer borealis | Allatostatin | Allatostatin A | 17381149#DeKeyser SS, Kutz-Naber KK, Schmidt JJ, Barrett-Wilt GA, Li L#Imaging mass spectrometry of neuropeptides in decapod crustacean neuronal tissues#J Proteome Res 2007 May;6(5):1782-91 | |
| NP00335 | ERPYSFGL |
8 | Cancer borealis | Allatostatin | Allatostatin A | 18700782#Behrens HL, Chen R, Li L#Combining microdialysis, NanoLC-MS, and MALDI-TOF/TOF to detect neuropeptides secreted in the crab, Cancer borealis#Anal Chem 2008 Sep 15;80(18):6949-58 | |
| NP00336 | ERPYSGL |
7 | Cancer borealis | Allatostatin | Allatostatin A | 19185513#Chen R, Ma M, Hui L, Zhang J, Li L#Measurement of neuropeptides in crustacean hemolymph via MALDI mass spectrometry#J Am Soc Mass Spectrom 2009 Apr;20(4):708-18 | |
| NP00337 | PDMYAFGL |
8 | Cancer borealis | Allatostatin | Allatostatin A | 18700782#Behrens HL, Chen R, Li L#Combining microdialysis, NanoLC-MS, and MALDI-TOF/TOF to detect neuropeptides secreted in the crab, Cancer borealis#Anal Chem 2008 Sep 15;80(18):6949-58 | |
| NP00338 | PRDYAFGL |
8 | Cancer borealis | Allatostatin | Allatostatin A | 17381149#DeKeyser SS, Kutz-Naber KK, Schmidt JJ, Barrett-Wilt GA, Li L#Imaging mass spectrometry of neuropeptides in decapod crustacean neuronal tissues#J Proteome Res 2007 May;6(5):1782-91 | |
| NP00339 | SPYAFGL |
7 | Cancer borealis | Allatostatin | Allatostatin A | 18700782#Behrens HL, Chen R, Li L#Combining microdialysis, NanoLC-MS, and MALDI-TOF/TOF to detect neuropeptides secreted in the crab, Cancer borealis#Anal Chem 2008 Sep 15;80(18):6949-58 | |
| NP00340 | YAFGL |
5 | Cancer borealis | Allatostatin | Allatostatin A | 18700782#Behrens HL, Chen R, Li L#Combining microdialysis, NanoLC-MS, and MALDI-TOF/TOF to detect neuropeptides secreted in the crab, Cancer borealis#Anal Chem 2008 Sep 15;80(18):6949-58 | |
| NP00341 | YSFGL |
5 | Cancer borealis | Allatostatin | Allatostatin A | 18700782#Behrens HL, Chen R, Li L#Combining microdialysis, NanoLC-MS, and MALDI-TOF/TOF to detect neuropeptides secreted in the crab, Cancer borealis#Anal Chem 2008 Sep 15;80(18):6949-58 | |
| NP00342 | GNWNKFQGSW |
10 | Cancer borealis | Allatostatin | Allatostatin B | 17381149#DeKeyser SS, Kutz-Naber KK, Schmidt JJ, Barrett-Wilt GA, Li L#Imaging mass spectrometry of neuropeptides in decapod crustacean neuronal tissues#J Proteome Res 2007 May;6(5):1782-91 | |
| NP00343 | NNNWSKFQGSW |
11 | Cancer borealis | Allatostatin | Allatostatin B | 18700782#Behrens HL, Chen R, Li L#Combining microdialysis, NanoLC-MS, and MALDI-TOF/TOF to detect neuropeptides secreted in the crab, Cancer borealis#Anal Chem 2008 Sep 15;80(18):6949-58 | |
| NP00344 | NNWSKFQGSW |
10 | Cancer borealis | Allatostatin | Allatostatin B | 17381149#DeKeyser SS, Kutz-Naber KK, Schmidt JJ, Barrett-Wilt GA, Li L#Imaging mass spectrometry of neuropeptides in decapod crustacean neuronal tissues#J Proteome Res 2007 May;6(5):1782-91 | |
| NP00345 | NWNKFQGSW |
9 | Cancer borealis | Allatostatin | Allatostatin B | 18700782#Behrens HL, Chen R, Li L#Combining microdialysis, NanoLC-MS, and MALDI-TOF/TOF to detect neuropeptides secreted in the crab, Cancer borealis#Anal Chem 2008 Sep 15;80(18):6949-58 | |
| NP00346 | STNWSSLRSAW |
11 | Cancer borealis | Allatostatin | Allatostatin B | 17381149#DeKeyser SS, Kutz-Naber KK, Schmidt JJ, Barrett-Wilt GA, Li L#Imaging mass spectrometry of neuropeptides in decapod crustacean neuronal tissues#J Proteome Res 2007 May;6(5):1782-91 | |
| NP00347 | TSWFKFQGSW |
10 | Cancer borealis | Allatostatin | Allatostatin B | 18700782#Behrens HL, Chen R, Li L#Combining microdialysis, NanoLC-MS, and MALDI-TOF/TOF to detect neuropeptides secreted in the crab, Cancer borealis#Anal Chem 2008 Sep 15;80(18):6949-58 | |
| NP00348 | VPNDWAHFRGSW |
12 | Cancer borealis | Allatostatin | Allatostatin B | 17381149#DeKeyser SS, Kutz-Naber KK, Schmidt JJ, Barrett-Wilt GA, Li L#Imaging mass spectrometry of neuropeptides in decapod crustacean neuronal tissues#J Proteome Res 2007 May;6(5):1782-91 | |
| NP00349 | GGSLYSFGL |
9 | Cancer borealis | Allatostatin | Allatostatin-3 | 14535947#Li L, Kelley WP, Billimoria CP, Christie AE, Pulver SR, Sweedler JV, Marder E#Mass spectrometric investigation of the neuropeptide complement and release in the pericardial organs of the crab, Cancer borealis#J Neurochem 2003 Nov;87(3):642-56 | |
| NP00350 | AWQDLQGGW |
9 | Carausius morosus | Allatostatin | Cam-AST-B1 | 16061202#Husson SJ, Clynen E, Baggerman G, De Loof A, Schoofs L#Discovering neuropeptides in Caenorhabditis elegans by two dimensional liquid chromatography and mass spectrometry#Biochem Biophys Res Commun 2005 Sep 16;335(1):76-86 | |
| NP00351 | AWQDLNTGW |
9 | Carausius morosus | Allatostatin | Cam-AST-B2 | 16061202#Husson SJ, Clynen E, Baggerman G, De Loof A, Schoofs L#Discovering neuropeptides in Caenorhabditis elegans by two dimensional liquid chromatography and mass spectrometry#Biochem Biophys Res Commun 2005 Sep 16;335(1):76-86 | |
| NP00352 | GWQDLQSGW |
9 | Carausius morosus | Allatostatin | Cam-AST-B3 | 16061202#Husson SJ, Clynen E, Baggerman G, De Loof A, Schoofs L#Discovering neuropeptides in Caenorhabditis elegans by two dimensional liquid chromatography and mass spectrometry#Biochem Biophys Res Commun 2005 Sep 16;335(1):76-86 | |
| NP00353 | AWQDLQGAW |
9 | Carausius morosus | Allatostatin | Cam-AST-B4 | 16061202#Husson SJ, Clynen E, Baggerman G, De Loof A, Schoofs L#Discovering neuropeptides in Caenorhabditis elegans by two dimensional liquid chromatography and mass spectrometry#Biochem Biophys Res Commun 2005 Sep 16;335(1):76-86 | |
| NP00354 | AWQDLQAGW |
9 | Carausius morosus | Allatostatin | Cam-AST-B5 | 16061202#Husson SJ, Clynen E, Baggerman G, De Loof A, Schoofs L#Discovering neuropeptides in Caenorhabditis elegans by two dimensional liquid chromatography and mass spectrometry#Biochem Biophys Res Commun 2005 Sep 16;335(1):76-86 | |
| NP00355 | AWQDLGSAW |
9 | Carausius morosus | Allatostatin | Cam-AST-B6 | 16061202#Husson SJ, Clynen E, Baggerman G, De Loof A, Schoofs L#Discovering neuropeptides in Caenorhabditis elegans by two dimensional liquid chromatography and mass spectrometry#Biochem Biophys Res Commun 2005 Sep 16;335(1):76-86 | |
| NP00356 | AAPYAFGL |
8 | Carcinus maenas | Allatostatin | Allatostatin A | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP00357 | AASPYSFGL |
9 | Carcinus maenas | Allatostatin | Allatostatin A | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP00358 | APGPYAFGL |
9 | Carcinus maenas | Allatostatin | Allatostatin A | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP00359 | ARPYAFGL |
8 | Carcinus maenas | Allatostatin | Allatostatin A | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP00360 | ARPYSFGL |
8 | Carcinus maenas | Allatostatin | Allatostatin A | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP00361 | EPYEFGL |
7 | Carcinus maenas | Allatostatin | Allatostatin A | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP00362 | FSGASPYGL |
9 | Carcinus maenas | Allatostatin | Allatostatin A | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP00363 | GKPYAFGL |
8 | Carcinus maenas | Allatostatin | Allatostatin A | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP00364 | KLPYSFGL |
8 | Carcinus maenas | Allatostatin | Allatostatin A | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP00365 | LKAYDFGL |
8 | Carcinus maenas | Allatostatin | Allatostatin A | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP00366 | PADLYEFGL |
9 | Carcinus maenas | Allatostatin | Allatostatin A | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP00367 | RGPYAFGL |
8 | Carcinus maenas | Allatostatin | Allatostatin A | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP00368 | TRPYSFGL |
8 | Carcinus maenas | Allatostatin | Allatostatin A | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP00369 | AGWNKFQGSW |
10 | Carcinus maenas | Allatostatin | Allatostatin B | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP00370 | AWSNLGQAW |
9 | Carcinus maenas | Allatostatin | Allatostatin B | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP00371 | GSNWSNLRGAW |
11 | Carcinus maenas | Allatostatin | Allatostatin B | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP00372 | GVNWSNLRGAW |
11 | Carcinus maenas | Allatostatin | Allatostatin B | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP00373 | NNNWSKFQGSW |
11 | Carcinus maenas | Allatostatin | Allatostatin B | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP00374 | NNWSKFQGSW |
10 | Carcinus maenas | Allatostatin | Allatostatin B | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP00375 | QWSSMRGAW |
9 | Carcinus maenas | Allatostatin | Allatostatin B | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP00376 | SGKWSNLRGAW |
11 | Carcinus maenas | Allatostatin | Allatostatin B | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP00377 | STNWSSLRSAW |
11 | Carcinus maenas | Allatostatin | Allatostatin B | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP00378 | TSWGKFQGSW |
10 | Carcinus maenas | Allatostatin | Allatostatin B | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP00379 | VPNDWAHFRGSW |
12 | Carcinus maenas | Allatostatin | Allatostatin B | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP00380 | VTWGKFQGSW |
10 | Carcinus maenas | Allatostatin | Allatostatin B | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP00381 | GGPYSXGL |
8 | Carcinus maenas | Allatostatin | Carcinustatin-16 | 9461295#Duve H, Johnsen AH, Maestro JL, Scott AG, Jaros PP, Thorpe A#Isolation and identification of multiple neuropeptides of the allatostatin superfamily in the shore crab Carcinus maenas#Eur J Biochem 1997 Dec 15;250(3):727-34 | |
| NP00382 | SFGGNPTGDPNLNIYSFGL |
19 | Daphnia pulex | Allatostatin | Allatostatin A1 | 21830762#Dircksen H, Neupert S, Predel R, Verleyen P, Huybrechts J, Strauss J, Hauser F, Stafflinger E, Schneider M, Pauwels K, Schoofs L, Grimmelikhuijzen CJ#Genomics, transcriptomics, and peptidomics of Daphnia pulex neuropeptides and protein hormones#J Proteome Res 2011 Oct 7;10(10):4478-504 | |
| NP00383 | TSRSYSINPYSFGL |
14 | Daphnia pulex | Allatostatin | Allatostatin A2 | 21830762#Dircksen H, Neupert S, Predel R, Verleyen P, Huybrechts J, Strauss J, Hauser F, Stafflinger E, Schneider M, Pauwels K, Schoofs L, Grimmelikhuijzen CJ#Genomics, transcriptomics, and peptidomics of Daphnia pulex neuropeptides and protein hormones#J Proteome Res 2011 Oct 7;10(10):4478-504 | |
| NP00384 | GGNAKSYPQQIPYSFGL |
17 | Daphnia pulex | Allatostatin | Allatostatin A3 | 21830762#Dircksen H, Neupert S, Predel R, Verleyen P, Huybrechts J, Strauss J, Hauser F, Stafflinger E, Schneider M, Pauwels K, Schoofs L, Grimmelikhuijzen CJ#Genomics, transcriptomics, and peptidomics of Daphnia pulex neuropeptides and protein hormones#J Proteome Res 2011 Oct 7;10(10):4478-504 | |
| NP00385 | NPTKYNFGL |
9 | Daphnia pulex | Allatostatin | Allatostatin A4 | 21830762#Dircksen H, Neupert S, Predel R, Verleyen P, Huybrechts J, Strauss J, Hauser F, Stafflinger E, Schneider M, Pauwels K, Schoofs L, Grimmelikhuijzen CJ#Genomics, transcriptomics, and peptidomics of Daphnia pulex neuropeptides and protein hormones#J Proteome Res 2011 Oct 7;10(10):4478-504 | |
| NP00386 | PDRFGFGL |
8 | Daphnia pulex | Allatostatin | Allatostatin A5 | 21830762#Dircksen H, Neupert S, Predel R, Verleyen P, Huybrechts J, Strauss J, Hauser F, Stafflinger E, Schneider M, Pauwels K, Schoofs L, Grimmelikhuijzen CJ#Genomics, transcriptomics, and peptidomics of Daphnia pulex neuropeptides and protein hormones#J Proteome Res 2011 Oct 7;10(10):4478-504 | |
| NP00387 | LPVYNFGL |
8 | Daphnia pulex | Allatostatin | Allatostatin A6 | 21830762#Dircksen H, Neupert S, Predel R, Verleyen P, Huybrechts J, Strauss J, Hauser F, Stafflinger E, Schneider M, Pauwels K, Schoofs L, Grimmelikhuijzen CJ#Genomics, transcriptomics, and peptidomics of Daphnia pulex neuropeptides and protein hormones#J Proteome Res 2011 Oct 7;10(10):4478-504 | |
| NP00388 | NNWNRMQGMW |
10 | Daphnia pulex | Allatostatin | Allatostatin B1 | 21830762#Dircksen H, Neupert S, Predel R, Verleyen P, Huybrechts J, Strauss J, Hauser F, Stafflinger E, Schneider M, Pauwels K, Schoofs L, Grimmelikhuijzen CJ#Genomics, transcriptomics, and peptidomics of Daphnia pulex neuropeptides and protein hormones#J Proteome Res 2011 Oct 7;10(10):4478-504 | |
| NP00389 | AWSDLSQQGW |
10 | Daphnia pulex | Allatostatin | Allatostatin B2 | 21830762#Dircksen H, Neupert S, Predel R, Verleyen P, Huybrechts J, Strauss J, Hauser F, Stafflinger E, Schneider M, Pauwels K, Schoofs L, Grimmelikhuijzen CJ#Genomics, transcriptomics, and peptidomics of Daphnia pulex neuropeptides and protein hormones#J Proteome Res 2011 Oct 7;10(10):4478-504 | |
| NP00390 | SWTQLHGVW |
9 | Daphnia pulex | Allatostatin | Allatostatin B3 | 21830762#Dircksen H, Neupert S, Predel R, Verleyen P, Huybrechts J, Strauss J, Hauser F, Stafflinger E, Schneider M, Pauwels K, Schoofs L, Grimmelikhuijzen CJ#Genomics, transcriptomics, and peptidomics of Daphnia pulex neuropeptides and protein hormones#J Proteome Res 2011 Oct 7;10(10):4478-504 | |
| NP00391 | RWDQLHGAW |
9 | Daphnia pulex | Allatostatin | Allatostatin B4 | 21830762#Dircksen H, Neupert S, Predel R, Verleyen P, Huybrechts J, Strauss J, Hauser F, Stafflinger E, Schneider M, Pauwels K, Schoofs L, Grimmelikhuijzen CJ#Genomics, transcriptomics, and peptidomics of Daphnia pulex neuropeptides and protein hormones#J Proteome Res 2011 Oct 7;10(10):4478-504 | |
| NP00392 | SGWNKMQGVW |
10 | Daphnia pulex | Allatostatin | Allatostatin B5 | 21830762#Dircksen H, Neupert S, Predel R, Verleyen P, Huybrechts J, Strauss J, Hauser F, Stafflinger E, Schneider M, Pauwels K, Schoofs L, Grimmelikhuijzen CJ#Genomics, transcriptomics, and peptidomics of Daphnia pulex neuropeptides and protein hormones#J Proteome Res 2011 Oct 7;10(10):4478-504 | |
| NP00393 | GWNQLQGVW |
9 | Daphnia pulex | Allatostatin | Allatostatin B6 | 21830762#Dircksen H, Neupert S, Predel R, Verleyen P, Huybrechts J, Strauss J, Hauser F, Stafflinger E, Schneider M, Pauwels K, Schoofs L, Grimmelikhuijzen CJ#Genomics, transcriptomics, and peptidomics of Daphnia pulex neuropeptides and protein hormones#J Proteome Res 2011 Oct 7;10(10):4478-504 | |
| NP00394 | NWNNLRGAW |
9 | Daphnia pulex | Allatostatin | Allatostatin B7 | 21830762#Dircksen H, Neupert S, Predel R, Verleyen P, Huybrechts J, Strauss J, Hauser F, Stafflinger E, Schneider M, Pauwels K, Schoofs L, Grimmelikhuijzen CJ#Genomics, transcriptomics, and peptidomics of Daphnia pulex neuropeptides and protein hormones#J Proteome Res 2011 Oct 7;10(10):4478-504 | |
| NP00395 | ESGWNNLKGLW |
11 | Daphnia pulex | Allatostatin | Allatostatin B8 | 21830762#Dircksen H, Neupert S, Predel R, Verleyen P, Huybrechts J, Strauss J, Hauser F, Stafflinger E, Schneider M, Pauwels K, Schoofs L, Grimmelikhuijzen CJ#Genomics, transcriptomics, and peptidomics of Daphnia pulex neuropeptides and protein hormones#J Proteome Res 2011 Oct 7;10(10):4478-504 | |
| NP00396 | SYWKQCAFNAVSCF |
14 | Daphnia pulex | Allatostatin | Allatostatin C1 | 21830762#Dircksen H, Neupert S, Predel R, Verleyen P, Huybrechts J, Strauss J, Hauser F, Stafflinger E, Schneider M, Pauwels K, Schoofs L, Grimmelikhuijzen CJ#Genomics, transcriptomics, and peptidomics of Daphnia pulex neuropeptides and protein hormones#J Proteome Res 2011 Oct 7;10(10):4478-504 | |
| NP00397 | GQSSQRVFWRCYFNAVSCF |
19 | Daphnia pulex | Allatostatin | Allatostatin C2 | 21830762#Dircksen H, Neupert S, Predel R, Verleyen P, Huybrechts J, Strauss J, Hauser F, Stafflinger E, Schneider M, Pauwels K, Schoofs L, Grimmelikhuijzen CJ#Genomics, transcriptomics, and peptidomics of Daphnia pulex neuropeptides and protein hormones#J Proteome Res 2011 Oct 7;10(10):4478-504 | |
| NP00398 | SKQLRYHHCYFNPISCF |
17 | Daphnia pulex | Allatostatin | Allatostatin C3 | 21830762#Dircksen H, Neupert S, Predel R, Verleyen P, Huybrechts J, Strauss J, Hauser F, Stafflinger E, Schneider M, Pauwels K, Schoofs L, Grimmelikhuijzen CJ#Genomics, transcriptomics, and peptidomics of Daphnia pulex neuropeptides and protein hormones#J Proteome Res 2011 Oct 7;10(10):4478-504 | |
| NP00399 | AYSYVSEYKRLPVYSFGL |
18 | Diploptera punctata | Allatostatin | Allatostatin B | 10545101#Birgül N, Weise C, Kreienkamp HJ, Richter D#Reverse physiology in drosophila: identification of a novel allatostatin-like neuropeptide and its cognate receptor structurally related to the mammalian somatostatin/galanin/opioid receptor family#EMBO J 1999 Nov 1;18(21):5892-900 | |
| NP00400 | EAQGWNKFRGAW |
12 | Drosophila melanogaster | Allatostatin | MIP3 | 16061202#Husson SJ, Clynen E, Baggerman G, De Loof A, Schoofs L#Discovering neuropeptides in Caenorhabditis elegans by two dimensional liquid chromatography and mass spectrometry#Biochem Biophys Res Commun 2005 Sep 16;335(1):76-86 | |
| NP00401 | SRPYLFGL |
8 | Galleria mellonella | Allatostatin | Bom-AST-3 | 15706623#Huybrechts J, Verleyen P, Schoofs L#Mass spectrometric analysis of head ganglia and neuroendocrine tissue of larval Galleria mellonella (Arthropoda, Insecta)#J Mass Spectrom 2005 Feb;40(2):271-6 | |
| NP00402 | ARPYSFGL |
8 | Galleria mellonella | Allatostatin | Bom-AST-4 | 15706623#Huybrechts J, Verleyen P, Schoofs L#Mass spectrometric analysis of head ganglia and neuroendocrine tissue of larval Galleria mellonella (Arthropoda, Insecta)#J Mass Spectrom 2005 Feb;40(2):271-6 | |
| NP00403 | LSSKFNFGL |
9 | Galleria mellonella | Allatostatin | Bom-AST-7 | 15706623#Huybrechts J, Verleyen P, Schoofs L#Mass spectrometric analysis of head ganglia and neuroendocrine tissue of larval Galleria mellonella (Arthropoda, Insecta)#J Mass Spectrom 2005 Feb;40(2):271-6 | |
| NP00404 | SRPYSFGL |
8 | Galleria mellonella | Allatostatin | Hea-AST-7 | 15706623#Huybrechts J, Verleyen P, Schoofs L#Mass spectrometric analysis of head ganglia and neuroendocrine tissue of larval Galleria mellonella (Arthropoda, Insecta)#J Mass Spectrom 2005 Feb;40(2):271-6 | |
| NP00405 | SPHYDFGL |
8 | Galleria mellonella | Allatostatin | Helicostatin-1 | 15706623#Huybrechts J, Verleyen P, Schoofs L#Mass spectrometric analysis of head ganglia and neuroendocrine tissue of larval Galleria mellonella (Arthropoda, Insecta)#J Mass Spectrom 2005 Feb;40(2):271-6 | |
| NP00406 | GWQDLNGGW |
9 | Gryllus bimaculatus | Allatostatin | Grb-AST-B1 | 16061202#Husson SJ, Clynen E, Baggerman G, De Loof A, Schoofs L#Discovering neuropeptides in Caenorhabditis elegans by two dimensional liquid chromatography and mass spectrometry#Biochem Biophys Res Commun 2005 Sep 16;335(1):76-86 | |
| NP00407 | GWRDLNGGW |
9 | Gryllus bimaculatus | Allatostatin | Grb-AST-B2 | 16061202#Husson SJ, Clynen E, Baggerman G, De Loof A, Schoofs L#Discovering neuropeptides in Caenorhabditis elegans by two dimensional liquid chromatography and mass spectrometry#Biochem Biophys Res Commun 2005 Sep 16;335(1):76-86 | |
| NP00408 | AWRDLSGGW |
9 | Gryllus bimaculatus | Allatostatin | Grb-AST-B3 | 16061202#Husson SJ, Clynen E, Baggerman G, De Loof A, Schoofs L#Discovering neuropeptides in Caenorhabditis elegans by two dimensional liquid chromatography and mass spectrometry#Biochem Biophys Res Commun 2005 Sep 16;335(1):76-86 | |
| NP00409 | AWERFHGSW |
9 | Gryllus bimaculatus | Allatostatin | Grb-AST-B4 | 16061202#Husson SJ, Clynen E, Baggerman G, De Loof A, Schoofs L#Discovering neuropeptides in Caenorhabditis elegans by two dimensional liquid chromatography and mass spectrometry#Biochem Biophys Res Commun 2005 Sep 16;335(1):76-86 | |
| NP00410 | AWQDLNAGW |
9 | Gryllus bimaculatus | Allatostatin | Locustamyoinhibiting peptide | 7673141#Lorenz MW, Kellner R, Hoffmann KH#A family of neuropeptides that inhibit juvenile hormone biosynthesis in the cricket, Gryllus bimaculatus#J Biol Chem 1995 Sep 8;270(36):21103-8 | |
| NP00411 | AGGAYSFGL |
9 | Homarus americanus | Allatostatin | Allatostatin A | 18304551#Ma M, Chen R, Sousa GL, Bors EK, Kwiatkowski MA, Goiney CC, Goy MF, Christie AE, Li L#Mass spectral characterization of peptide transmitters/hormones in the nervous system and neuroendocrine organs of the American lobster Homarus americanus#Gen Comp Endocrinol 2008 Apr 1;156(2):395-409 | |
| NP00412 | AGPYAFGL |
8 | Homarus americanus | Allatostatin | Allatostatin A | 18304551#Ma M, Chen R, Sousa GL, Bors EK, Kwiatkowski MA, Goiney CC, Goy MF, Christie AE, Li L#Mass spectral characterization of peptide transmitters/hormones in the nervous system and neuroendocrine organs of the American lobster Homarus americanus#Gen Comp Endocrinol 2008 Apr 1;156(2):395-409 | |
| NP00413 | AGPYSFGL |
8 | Homarus americanus | Allatostatin | Allatostatin A | 18088365#Cape SS, Rehm KJ, Ma M, Marder E, Li L#Mass spectral comparison of the neuropeptide complement of the stomatogastric ganglion and brain in the adult and embryonic lobster, Homarus americanus#J Neurochem 2008 May;105(3):690-702 | |
| NP00414 | ASPYAFGL |
8 | Homarus americanus | Allatostatin | Allatostatin A | 20025296#Chen R, Jiang X, Conaway MC, Mohtashemi I, Hui L, Viner R, Li L#Mass spectral analysis of neuropeptide expression and distribution in the nervous system of the lobster Homarus americanus#J Proteome Res 2010 Feb 5;9(2):818-32 | |
| NP00415 | EPYAFGL |
7 | Homarus americanus | Allatostatin | Allatostatin A | 18304551#Ma M, Chen R, Sousa GL, Bors EK, Kwiatkowski MA, Goiney CC, Goy MF, Christie AE, Li L#Mass spectral characterization of peptide transmitters/hormones in the nervous system and neuroendocrine organs of the American lobster Homarus americanus#Gen Comp Endocrinol 2008 Apr 1;156(2):395-409 | |
| NP00416 | ERAYSFGL |
8 | Homarus americanus | Allatostatin | Allatostatin A | 20025296#Chen R, Jiang X, Conaway MC, Mohtashemi I, Hui L, Viner R, Li L#Mass spectral analysis of neuropeptide expression and distribution in the nervous system of the lobster Homarus americanus#J Proteome Res 2010 Feb 5;9(2):818-32 | |
| NP00417 | PRDYAFGL |
8 | Homarus americanus | Allatostatin | Allatostatin A | 22860213#Jiang X, Chen R, Wang J, Metzler A, Tlusty M, Li L#Mass spectral charting of neuropeptidomic expression in the stomatogastric ganglion at multiple developmental stages of the lobster Homarus americanus#ACS Chem Neurosci 2012 Jun 20;3(6):439-50 | |
| NP00418 | PRNYAFGL |
8 | Homarus americanus | Allatostatin | Allatostatin A | 22860213#Jiang X, Chen R, Wang J, Metzler A, Tlusty M, Li L#Mass spectral charting of neuropeptidomic expression in the stomatogastric ganglion at multiple developmental stages of the lobster Homarus americanus#ACS Chem Neurosci 2012 Jun 20;3(6):439-50 | |
| NP00419 | RQYAFGL |
7 | Homarus americanus | Allatostatin | Allatostatin A | 22860213#Jiang X, Chen R, Wang J, Metzler A, Tlusty M, Li L#Mass spectral charting of neuropeptidomic expression in the stomatogastric ganglion at multiple developmental stages of the lobster Homarus americanus#ACS Chem Neurosci 2012 Jun 20;3(6):439-50 | |
| NP00420 | SGPYAFGL |
8 | Homarus americanus | Allatostatin | Allatostatin A | 18304551#Ma M, Chen R, Sousa GL, Bors EK, Kwiatkowski MA, Goiney CC, Goy MF, Christie AE, Li L#Mass spectral characterization of peptide transmitters/hormones in the nervous system and neuroendocrine organs of the American lobster Homarus americanus#Gen Comp Endocrinol 2008 Apr 1;156(2):395-409 | |
| NP00421 | SGPYSFGL |
8 | Homarus americanus | Allatostatin | Allatostatin A | 18304551#Ma M, Chen R, Sousa GL, Bors EK, Kwiatkowski MA, Goiney CC, Goy MF, Christie AE, Li L#Mass spectral characterization of peptide transmitters/hormones in the nervous system and neuroendocrine organs of the American lobster Homarus americanus#Gen Comp Endocrinol 2008 Apr 1;156(2):395-409 | |
| NP00422 | SPYAFGL |
7 | Homarus americanus | Allatostatin | Allatostatin A | 18304551#Ma M, Chen R, Sousa GL, Bors EK, Kwiatkowski MA, Goiney CC, Goy MF, Christie AE, Li L#Mass spectral characterization of peptide transmitters/hormones in the nervous system and neuroendocrine organs of the American lobster Homarus americanus#Gen Comp Endocrinol 2008 Apr 1;156(2):395-409 | |
| NP00423 | SQYTFGL |
7 | Homarus americanus | Allatostatin | Allatostatin A | 18304551#Ma M, Chen R, Sousa GL, Bors EK, Kwiatkowski MA, Goiney CC, Goy MF, Christie AE, Li L#Mass spectral characterization of peptide transmitters/hormones in the nervous system and neuroendocrine organs of the American lobster Homarus americanus#Gen Comp Endocrinol 2008 Apr 1;156(2):395-409 | |
| NP00424 | TPSYAFGL |
8 | Homarus americanus | Allatostatin | Allatostatin A | 18304551#Ma M, Chen R, Sousa GL, Bors EK, Kwiatkowski MA, Goiney CC, Goy MF, Christie AE, Li L#Mass spectral characterization of peptide transmitters/hormones in the nervous system and neuroendocrine organs of the American lobster Homarus americanus#Gen Comp Endocrinol 2008 Apr 1;156(2):395-409 | |
| NP00425 | VGPYAFGL |
8 | Homarus americanus | Allatostatin | Allatostatin A | 18304551#Ma M, Chen R, Sousa GL, Bors EK, Kwiatkowski MA, Goiney CC, Goy MF, Christie AE, Li L#Mass spectral characterization of peptide transmitters/hormones in the nervous system and neuroendocrine organs of the American lobster Homarus americanus#Gen Comp Endocrinol 2008 Apr 1;156(2):395-409 | |
| NP00426 | VPRYAFG |
7 | Homarus americanus | Allatostatin | Allatostatin A | 20025296#Chen R, Jiang X, Conaway MC, Mohtashemi I, Hui L, Viner R, Li L#Mass spectral analysis of neuropeptide expression and distribution in the nervous system of the lobster Homarus americanus#J Proteome Res 2010 Feb 5;9(2):818-32 | |
| NP00427 | GNWNKFQGSW |
10 | Homarus americanus | Allatostatin | Allatostatin B | 18304551#Ma M, Chen R, Sousa GL, Bors EK, Kwiatkowski MA, Goiney CC, Goy MF, Christie AE, Li L#Mass spectral characterization of peptide transmitters/hormones in the nervous system and neuroendocrine organs of the American lobster Homarus americanus#Gen Comp Endocrinol 2008 Apr 1;156(2):395-409 | |
| NP00428 | NWNKFQGSW |
9 | Homarus americanus | Allatostatin | Allatostatin B | 18304551#Ma M, Chen R, Sousa GL, Bors EK, Kwiatkowski MA, Goiney CC, Goy MF, Christie AE, Li L#Mass spectral characterization of peptide transmitters/hormones in the nervous system and neuroendocrine organs of the American lobster Homarus americanus#Gen Comp Endocrinol 2008 Apr 1;156(2):395-409 | |
| NP00429 | STNWSSLRSAW |
11 | Homarus americanus | Allatostatin | Allatostatin B | 22860213#Jiang X, Chen R, Wang J, Metzler A, Tlusty M, Li L#Mass spectral charting of neuropeptidomic expression in the stomatogastric ganglion at multiple developmental stages of the lobster Homarus americanus#ACS Chem Neurosci 2012 Jun 20;3(6):439-50 | |
| NP00430 | TNWNKFQGSW |
10 | Homarus americanus | Allatostatin | Allatostatin B | 22860213#Jiang X, Chen R, Wang J, Metzler A, Tlusty M, Li L#Mass spectral charting of neuropeptidomic expression in the stomatogastric ganglion at multiple developmental stages of the lobster Homarus americanus#ACS Chem Neurosci 2012 Jun 20;3(6):439-50 | |
| NP00431 | QIRYHQCYFNPISCF |
15 | Homarus americanus | Allatostatin | Allatostatin C | 20025296#Chen R, Jiang X, Conaway MC, Mohtashemi I, Hui L, Viner R, Li L#Mass spectral analysis of neuropeptide expression and distribution in the nervous system of the lobster Homarus americanus#J Proteome Res 2010 Feb 5;9(2):818-32 | |
| NP00432 | SGWKQCSFNAVSCF |
14 | Ixodes scapularis | Allatostatin | Allatostatin-C | 19540946#Neupert S, Russell WK, Predel R, Russell DH, Strey OF, Teel PD, Nachman RJ#The neuropeptidomics of Ixodes scapularis synganglion#J Proteomics 2009 Aug 20;72(6):1040-5 | |
| NP00433 | ASDWNRLSGMW |
11 | Ixodes scapularis | Allatostatin | Myoinhibitory peptide | 19540946#Neupert S, Russell WK, Predel R, Russell DH, Strey OF, Teel PD, Nachman RJ#The neuropeptidomics of Ixodes scapularis synganglion#J Proteomics 2009 Aug 20;72(6):1040-5 | |
| NP00434 | ANQYAFGL |
8 | Litopenaeus vannamei | Allatostatin | Allatostatin A | 19852991#Ma M, Gard AL, Xiang F, Wang J, Davoodian N, Lenz PH, Malecha SR, Christie AE, Li L#Combining in silico transcriptome mining and biological mass spectrometry for neuropeptide discovery in the Pacific white shrimp Litopenaeus vannamei#Peptides 2010 Jan;31(1):27-43 | |
| NP00435 | DRLYAFGL |
8 | Litopenaeus vannamei | Allatostatin | Allatostatin A | 19852991#Ma M, Gard AL, Xiang F, Wang J, Davoodian N, Lenz PH, Malecha SR, Christie AE, Li L#Combining in silico transcriptome mining and biological mass spectrometry for neuropeptide discovery in the Pacific white shrimp Litopenaeus vannamei#Peptides 2010 Jan;31(1):27-43 | |
| NP00436 | HGSYAFGL |
8 | Litopenaeus vannamei | Allatostatin | Allatostatin A | 19852991#Ma M, Gard AL, Xiang F, Wang J, Davoodian N, Lenz PH, Malecha SR, Christie AE, Li L#Combining in silico transcriptome mining and biological mass spectrometry for neuropeptide discovery in the Pacific white shrimp Litopenaeus vannamei#Peptides 2010 Jan;31(1):27-43 | |
| NP00437 | SSKPYAFGL |
9 | Litopenaeus vannamei | Allatostatin | Allatostatin A | 19852991#Ma M, Gard AL, Xiang F, Wang J, Davoodian N, Lenz PH, Malecha SR, Christie AE, Li L#Combining in silico transcriptome mining and biological mass spectrometry for neuropeptide discovery in the Pacific white shrimp Litopenaeus vannamei#Peptides 2010 Jan;31(1):27-43 | |
| NP00438 | ADWNKFQGSW |
10 | Litopenaeus vannamei | Allatostatin | Allatostatin B | 19852991#Ma M, Gard AL, Xiang F, Wang J, Davoodian N, Lenz PH, Malecha SR, Christie AE, Li L#Combining in silico transcriptome mining and biological mass spectrometry for neuropeptide discovery in the Pacific white shrimp Litopenaeus vannamei#Peptides 2010 Jan;31(1):27-43 | |
| NP00439 | KWAAGRSAW |
9 | Litopenaeus vannamei | Allatostatin | Allatostatin B | 19852991#Ma M, Gard AL, Xiang F, Wang J, Davoodian N, Lenz PH, Malecha SR, Christie AE, Li L#Combining in silico transcriptome mining and biological mass spectrometry for neuropeptide discovery in the Pacific white shrimp Litopenaeus vannamei#Peptides 2010 Jan;31(1):27-43 | |
| NP00440 | LTWNKFQGSW |
10 | Litopenaeus vannamei | Allatostatin | Allatostatin B | 19852991#Ma M, Gard AL, Xiang F, Wang J, Davoodian N, Lenz PH, Malecha SR, Christie AE, Li L#Combining in silico transcriptome mining and biological mass spectrometry for neuropeptide discovery in the Pacific white shrimp Litopenaeus vannamei#Peptides 2010 Jan;31(1):27-43 | |
| NP00441 | NWNKFQGSW |
9 | Litopenaeus vannamei | Allatostatin | Allatostatin B | 19852991#Ma M, Gard AL, Xiang F, Wang J, Davoodian N, Lenz PH, Malecha SR, Christie AE, Li L#Combining in silico transcriptome mining and biological mass spectrometry for neuropeptide discovery in the Pacific white shrimp Litopenaeus vannamei#Peptides 2010 Jan;31(1):27-43 | |
| NP00442 | RWSKFQGSW |
9 | Litopenaeus vannamei | Allatostatin | Allatostatin B | 19852991#Ma M, Gard AL, Xiang F, Wang J, Davoodian N, Lenz PH, Malecha SR, Christie AE, Li L#Combining in silico transcriptome mining and biological mass spectrometry for neuropeptide discovery in the Pacific white shrimp Litopenaeus vannamei#Peptides 2010 Jan;31(1):27-43 | |
| NP00443 | SADWNSLRGTW |
11 | Litopenaeus vannamei | Allatostatin | Allatostatin B | 19852991#Ma M, Gard AL, Xiang F, Wang J, Davoodian N, Lenz PH, Malecha SR, Christie AE, Li L#Combining in silico transcriptome mining and biological mass spectrometry for neuropeptide discovery in the Pacific white shrimp Litopenaeus vannamei#Peptides 2010 Jan;31(1):27-43 | |
| NP00444 | STNWSNLRGTW |
11 | Litopenaeus vannamei | Allatostatin | Allatostatin B | 19852991#Ma M, Gard AL, Xiang F, Wang J, Davoodian N, Lenz PH, Malecha SR, Christie AE, Li L#Combining in silico transcriptome mining and biological mass spectrometry for neuropeptide discovery in the Pacific white shrimp Litopenaeus vannamei#Peptides 2010 Jan;31(1):27-43 | |
| NP00445 | VPNDWAHFRGSW |
12 | Litopenaeus vannamei | Allatostatin | Allatostatin B | 19852991#Ma M, Gard AL, Xiang F, Wang J, Davoodian N, Lenz PH, Malecha SR, Christie AE, Li L#Combining in silico transcriptome mining and biological mass spectrometry for neuropeptide discovery in the Pacific white shrimp Litopenaeus vannamei#Peptides 2010 Jan;31(1):27-43 | |
| NP00446 | VERYAFGL |
8 | Lucilia cuprina | Allatostatin | Allatostatin 1 | 23280433#Rahman MM, Neupert S, Predel R#Neuropeptidomics of the Australian sheep blowfly Lucilia cuprina (Wiedemann) and related Diptera#Peptides 2013 Mar;41:31-7 | |
| NP00447 | ARPYSFGL |
8 | Lucilia cuprina | Allatostatin | Allatostatin 3 | 23280433#Rahman MM, Neupert S, Predel R#Neuropeptidomics of the Australian sheep blowfly Lucilia cuprina (Wiedemann) and related Diptera#Peptides 2013 Mar;41:31-7 | |
| NP00448 | NRPYSFGL |
8 | Lucilia cuprina | Allatostatin | Allatostatin-4 | 23280433#Rahman MM, Neupert S, Predel R#Neuropeptidomics of the Australian sheep blowfly Lucilia cuprina (Wiedemann) and related Diptera#Peptides 2013 Mar;41:31-7 | |
| NP00449 | DPLNEERRANRYGFGL |
16 | Lucilia cuprina | Allatostatin | Allatostatin-5 | 23280433#Rahman MM, Neupert S, Predel R#Neuropeptidomics of the Australian sheep blowfly Lucilia cuprina (Wiedemann) and related Diptera#Peptides 2013 Mar;41:31-7 | |
| NP00450 | ANRYGFGL |
8 | Lucilia cuprina | Allatostatin | Callatostatin-3 | 23280433#Rahman MM, Neupert S, Predel R#Neuropeptidomics of the Australian sheep blowfly Lucilia cuprina (Wiedemann) and related Diptera#Peptides 2013 Mar;41:31-7 | |
| NP00451 | EVRFRQCYFNPISCF |
15 | Manduca sexta | Allatostatin | Allatostatin | 14599724#Audsley N, Weaver RJ#A comparison of the neuropeptides from the retrocerebral complex of adult male and female Manduca sexta using MALDI-TOF mass spectrometry#Regul Pept 2003 Nov 15;116(1-3):127-37 | |
| NP00452 | AYSYVSEYKRLPVYNFGL |
18 | Manduca sexta | Allatostatin | Cydiastatin 2 | 14599724#Audsley N, Weaver RJ#A comparison of the neuropeptides from the retrocerebral complex of adult male and female Manduca sexta using MALDI-TOF mass spectrometry#Regul Pept 2003 Nov 15;116(1-3):127-37 | |
| NP00453 | LPVYNFGL |
8 | Manduca sexta | Allatostatin | Cydiastatin 2 11–18 | 14599724#Audsley N, Weaver RJ#A comparison of the neuropeptides from the retrocerebral complex of adult male and female Manduca sexta using MALDI-TOF mass spectrometry#Regul Pept 2003 Nov 15;116(1-3):127-37 | |
| NP00454 | SRPYSFGL |
8 | Manduca sexta | Allatostatin | Cydiastatin 3 | 14599724#Audsley N, Weaver RJ#A comparison of the neuropeptides from the retrocerebral complex of adult male and female Manduca sexta using MALDI-TOF mass spectrometry#Regul Pept 2003 Nov 15;116(1-3):127-37 | |
| NP00455 | ARPYSFGL |
8 | Manduca sexta | Allatostatin | Cydiastatin 4 | 14599724#Audsley N, Weaver RJ#A comparison of the neuropeptides from the retrocerebral complex of adult male and female Manduca sexta using MALDI-TOF mass spectrometry#Regul Pept 2003 Nov 15;116(1-3):127-37 | |
| NP00456 | SPHYDFGL |
8 | Manduca sexta | Allatostatin | Helicostatin-1 | 14599724#Audsley N, Weaver RJ#A comparison of the neuropeptides from the retrocerebral complex of adult male and female Manduca sexta using MALDI-TOF mass spectrometry#Regul Pept 2003 Nov 15;116(1-3):127-37 | |
| NP00457 | ARAYDFGL |
8 | Manduca sexta | Allatostatin | Helicostatin-5 | 14706525#Audsley N, Weaver RJ#Identification of neuropeptides from brains of larval Manduca sexta and Lacanobia oleracea using MALDI-TOF mass spectrometry and post-source decay#Peptides 2003 Oct;24(10):1465-74 | |
| NP00458 | LPMYNFGL |
8 | Manduca sexta | Allatostatin | Helicostatin-6 | 14599724#Audsley N, Weaver RJ#A comparison of the neuropeptides from the retrocerebral complex of adult male and female Manduca sexta using MALDI-TOF mass spectrometry#Regul Pept 2003 Nov 15;116(1-3):127-37 | |
| NP00459 | ARSYNFGL |
8 | Manduca sexta | Allatostatin | Helicostatin-7 | 14599724#Audsley N, Weaver RJ#A comparison of the neuropeptides from the retrocerebral complex of adult male and female Manduca sexta using MALDI-TOF mass spectrometry#Regul Pept 2003 Nov 15;116(1-3):127-37 | |
| NP00460 | ERDMHRFSFGL |
11 | Manduca sexta | Allatostatin | Helicostatin-9 | 14706525#Audsley N, Weaver RJ#Identification of neuropeptides from brains of larval Manduca sexta and Lacanobia oleracea using MALDI-TOF mass spectrometry and post-source decay#Peptides 2003 Oct;24(10):1465-74 | |
| NP00461 | GWQDLNSAW |
9 | Manduca sexta | Allatostatin | Mas-MIP II | 16061202#Husson SJ, Clynen E, Baggerman G, De Loof A, Schoofs L#Discovering neuropeptides in Caenorhabditis elegans by two dimensional liquid chromatography and mass spectrometry#Biochem Biophys Res Commun 2005 Sep 16;335(1):76-86 | |
| NP00462 | AWQDLNSAW |
9 | Manduca sexta | Allatostatin | Mas-MIP1 | 16061202#Husson SJ, Clynen E, Baggerman G, De Loof A, Schoofs L#Discovering neuropeptides in Caenorhabditis elegans by two dimensional liquid chromatography and mass spectrometry#Biochem Biophys Res Commun 2005 Sep 16;335(1):76-86 | |
| NP00463 | APEKWAAFHGSW |
12 | Manduca sexta | Allatostatin | MIP III | 14599724#Audsley N, Weaver RJ#A comparison of the neuropeptides from the retrocerebral complex of adult male and female Manduca sexta using MALDI-TOF mass spectrometry#Regul Pept 2003 Nov 15;116(1-3):127-37 | |
| NP00464 | GWQDMSSAW |
9 | Manduca sexta | Allatostatin | MIP V | 14599724#Audsley N, Weaver RJ#A comparison of the neuropeptides from the retrocerebral complex of adult male and female Manduca sexta using MALDI-TOF mass spectrometry#Regul Pept 2003 Nov 15;116(1-3):127-37 | |
| NP00465 | AWSALHGAW |
9 | Manduca sexta | Allatostatin | MIP VI | 14599724#Audsley N, Weaver RJ#A comparison of the neuropeptides from the retrocerebral complex of adult male and female Manduca sexta using MALDI-TOF mass spectrometry#Regul Pept 2003 Nov 15;116(1-3):127-37 | |
| NP00466 | LPIYQFGL |
8 | Nasonia vitripennis | Allatostatin | Allatostatin-A-1 | 20695486#Hauser F, Neupert S, Williamson M, Predel R, Tanaka Y, Grimmelikhuijzen CJ#Genomics and peptidomics of neuropeptides and protein hormones present in the parasitic wasp Nasonia vitripennis#J Proteome Res 2010 Oct 1;9(10):5296-310 | |
| NP00467 | SQPFSFGL |
8 | Nasonia vitripennis | Allatostatin | Allatostatin-A-2 | 20695486#Hauser F, Neupert S, Williamson M, Predel R, Tanaka Y, Grimmelikhuijzen CJ#Genomics and peptidomics of neuropeptides and protein hormones present in the parasitic wasp Nasonia vitripennis#J Proteome Res 2010 Oct 1;9(10):5296-310 | |
| NP00468 | TRPYSFGL |
8 | Nasonia vitripennis | Allatostatin | Allatostatin-A-3 | 20695486#Hauser F, Neupert S, Williamson M, Predel R, Tanaka Y, Grimmelikhuijzen CJ#Genomics and peptidomics of neuropeptides and protein hormones present in the parasitic wasp Nasonia vitripennis#J Proteome Res 2010 Oct 1;9(10):5296-310 | |
| NP00469 | DKYLFGL |
7 | Nasonia vitripennis | Allatostatin | Allatostatin-A-5 | 20695486#Hauser F, Neupert S, Williamson M, Predel R, Tanaka Y, Grimmelikhuijzen CJ#Genomics and peptidomics of neuropeptides and protein hormones present in the parasitic wasp Nasonia vitripennis#J Proteome Res 2010 Oct 1;9(10):5296-310 | |
| NP00470 | AGPYAFGL |
8 | Ocypode ceratophthalma | Allatostatin | Allatostatin A | 23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34 | |
| NP00471 | ARPYSFGL |
8 | Ocypode ceratophthalma | Allatostatin | Allatostatin A | 23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34 | |
| NP00472 | DGPYSFGL |
8 | Ocypode ceratophthalma | Allatostatin | Allatostatin A | 23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34 | |
| NP00473 | EAYAGFL |
7 | Ocypode ceratophthalma | Allatostatin | Allatostatin A | 23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34 | |
| NP00474 | EPQYSFGL |
8 | Ocypode ceratophthalma | Allatostatin | Allatostatin A | 23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34 | |
| NP00475 | EPYAFGL |
7 | Ocypode ceratophthalma | Allatostatin | Allatostatin A | 23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34 | |
| NP00476 | FSGASPYGL |
9 | Ocypode ceratophthalma | Allatostatin | Allatostatin A | 23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34 | |
| NP00477 | KLPTGYQFGL |
10 | Ocypode ceratophthalma | Allatostatin | Allatostatin A | 23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34 | |
| NP00478 | PRDYAFGL |
8 | Ocypode ceratophthalma | Allatostatin | Allatostatin A | 23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34 | |
| NP00479 | RGPYAFGL |
8 | Ocypode ceratophthalma | Allatostatin | Allatostatin A | 23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34 | |
| NP00480 | SDMYSFGL |
8 | Ocypode ceratophthalma | Allatostatin | Allatostatin A | 23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34 | |
| NP00481 | SGHYIFGL |
8 | Ocypode ceratophthalma | Allatostatin | Allatostatin A | 23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34 | |
| NP00482 | SNPYSFGL |
8 | Ocypode ceratophthalma | Allatostatin | Allatostatin A | 23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34 | |
| NP00483 | SRPYSFGL |
8 | Ocypode ceratophthalma | Allatostatin | Allatostatin A | 23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34 | |
| NP00484 | TRPYSFGL |
8 | Ocypode ceratophthalma | Allatostatin | Allatostatin A | 23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34 | |
| NP00485 | YDFEASSYSFGL |
12 | Ocypode ceratophthalma | Allatostatin | Allatostatin A | 23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34 | |
| NP00486 | AWSNLGQAW |
9 | Ocypode ceratophthalma | Allatostatin | Allatostatin B | 23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34 | |
| NP00487 | DDWSQFQGSW |
10 | Ocypode ceratophthalma | Allatostatin | Allatostatin B | 23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34 | |
| NP00488 | DGSSNLRGAW |
10 | Ocypode ceratophthalma | Allatostatin | Allatostatin B | 23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34 | |
| NP00489 | GNWNKFQGSW |
10 | Ocypode ceratophthalma | Allatostatin | Allatostatin B | 23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34 | |
| NP00490 | NNWSKFQGSW |
10 | Ocypode ceratophthalma | Allatostatin | Allatostatin B | 23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34 | |
| NP00491 | SDGWSPSGDGSW |
12 | Ocypode ceratophthalma | Allatostatin | Allatostatin B | 23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34 | |
| NP00492 | SGDWSSLRGAW |
11 | Ocypode ceratophthalma | Allatostatin | Allatostatin B | 23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34 | |
| NP00493 | SPNDWAHFRGSW |
12 | Ocypode ceratophthalma | Allatostatin | Allatostatin B | 23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34 | |
| NP00494 | STNWSSCPTSAW |
12 | Ocypode ceratophthalma | Allatostatin | Allatostatin B | 23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34 | |
| NP00495 | STNWSSLRSAW |
11 | Ocypode ceratophthalma | Allatostatin | Allatostatin B | 23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34 | |
| NP00496 | TGWSSTSRAW |
10 | Ocypode ceratophthalma | Allatostatin | Allatostatin B | 23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34 | |
| NP00497 | TGWSVFQGSW |
10 | Ocypode ceratophthalma | Allatostatin | Allatostatin B | 23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34 | |
| NP00498 | TQWSKFQGSW |
10 | Ocypode ceratophthalma | Allatostatin | Allatostatin B | 23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34 | |
| NP00499 | TSWGKFQGSW |
10 | Ocypode ceratophthalma | Allatostatin | Allatostatin B | 23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34 | |
| NP00500 | TSWGKYQGSW |
10 | Ocypode ceratophthalma | Allatostatin | Allatostatin B | 23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34 | |
| NP00501 | ANEDEDAASLFAFGL |
15 | Penaeus monodon | Allatostatin | Allatostatin | 21459120#Chansela P, Goto-Inoue N, Zaima N, Sroyraya M, Sobhon P, Setou M#Visualization of neuropeptides in paraffin-embedded tissue sections of the central nervous system in the decapod crustacean, Penaeus monodon, by imaging mass spectrometry#Peptides 2012 Mar;34(1):10-8 | |
| NP00502 | SGHYNFGL |
8 | Penaeus monodon | Allatostatin | Allatostatin A | 21459120#Chansela P, Goto-Inoue N, Zaima N, Sroyraya M, Sobhon P, Setou M#Visualization of neuropeptides in paraffin-embedded tissue sections of the central nervous system in the decapod crustacean, Penaeus monodon, by imaging mass spectrometry#Peptides 2012 Mar;34(1):10-8 | |
| NP00503 | NWGQFHGGW |
9 | Zophobas atratus | Allatostatin | Trica-MIP-4 | 21067424#Marciniak P, Audsley N, Kuczer M, Rosinski G#Identification of myotropic neuropeptides from the brain and corpus cardiacum-corpus allatum complex of the beetle, Zophobas atratus#J Insect Sci 2010;10:156 | |
| NP00504 | AYTYVSEY |
8 | Apis mellifera | Allatostatin | Allatostatin-1 | 17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J., Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L., Robinson G.E., Sweedler J.V.; #From the genome to the proteome: uncovering peptides in the Apis brain.; #Science 314:647-649(2006). | |
| NP00505 | LPVYNFGI |
8 | Apis mellifera | Allatostatin | Allatostatin-2a | 17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J., Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L., Robinson G.E., Sweedler J.V.; #From the genome to the proteome: uncovering peptides in the Apis brain.; #Science 314:647-649(2006). | |
| NP00506 | LPVYNF |
6 | Apis mellifera | Allatostatin | Allatostatin-2b | 17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J., Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L., Robinson G.E., Sweedler J.V.; #From the genome to the proteome: uncovering peptides in the Apis brain.; #Science 314:647-649(2006). | |
| NP00507 | GRDYSFGL |
8 | Apis mellifera | Allatostatin | Allatostatin-3 | 17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J., Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L., Robinson G.E., Sweedler J.V.; #From the genome to the proteome: uncovering peptides in the Apis brain.; #Science 314:647-649(2006). | |
| NP00508 | RQYSFGL |
7 | Apis mellifera | Allatostatin | Allatostatin-4 | 17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J., Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L., Robinson G.E., Sweedler J.V.; #From the genome to the proteome: uncovering peptides in the Apis brain.; #Science 314:647-649(2006). | |
| NP00509 | NDNADYPLRLNLDYLPVDNPAFHSQENTDDFLEE |
34 | Apis mellifera | Allatostatin | Allatostatin-5 | 17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J., Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L., Robinson G.E., Sweedler J.V.; #From the genome to the proteome: uncovering peptides in the Apis brain.; #Science 314:647-649(2006). | |
| NP00510 | GRQPYSFGL |
9 | Apis mellifera | Allatostatin | Allatostatin-6 | 17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J., Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L., Robinson G.E., Sweedler J.V.; #From the genome to the proteome: uncovering peptides in the Apis brain.; #Science 314:647-649(2006). | |
| NP00511 | AVHYSGGQPLGSKRPNDMLSQRYHFGL |
27 | Apis mellifera | Allatostatin | Allatostatin-7a | 17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J., Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L., Robinson G.E., Sweedler J.V.; #From the genome to the proteome: uncovering peptides in the Apis brain.; #Science 314:647-649(2006). | |
| NP00512 | AVHYSGGQPLGS |
12 | Apis mellifera | Allatostatin | Allatostatin-7b | 17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J., Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L., Robinson G.E., Sweedler J.V.; #From the genome to the proteome: uncovering peptides in the Apis brain.; #Science 314:647-649(2006). | |
| NP00513 | PNDMLSQRYHFGL |
13 | Apis mellifera | Allatostatin | Allatostatin-7c | 17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J., Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L., Robinson G.E., Sweedler J.V.; #From the genome to the proteome: uncovering peptides in the Apis brain.; #Science 314:647-649(2006). | |
| NP00514 | DPLNEERRANRYGFGL |
16 | Calliphora vomitoria | Allatostatin | Callatostatin-1 | 8460157#Duve H., Johnsen A.H., Scott A.G., Yu C.G., Yagi K.J., Tobe S.S., Thorpe A.; #Callatostatins: neuropeptides from the blowfly Calliphora vomitoria with sequence homology to cockroach allatostatins.; #Proc. Natl. Acad. Sci. U.S.A. 90:2456-2460(1993). | |
| NP00515 | LNEERRANRYGFGL |
14 | Calliphora vomitoria | Allatostatin | Callatostatin-2 | 8460157#Duve H., Johnsen A.H., Scott A.G., Yu C.G., Yagi K.J., Tobe S.S., Thorpe A.; #Callatostatins: neuropeptides from the blowfly Calliphora vomitoria with sequence homology to cockroach allatostatins.; #Proc. Natl. Acad. Sci. U.S.A. 90:2456-2460(1993). | |
| NP00516 | ANRYGFGL |
8 | Calliphora vomitoria | Allatostatin | Callatostatin-3 | 8460157#Duve H., Johnsen A.H., Scott A.G., Yu C.G., Yagi K.J., Tobe S.S., Thorpe A.; #Callatostatins: neuropeptides from the blowfly Calliphora vomitoria with sequence homology to cockroach allatostatins.; #Proc. Natl. Acad. Sci. U.S.A. 90:2456-2460(1993). | |
| NP00517 | DRPYSFGL |
8 | Calliphora vomitoria | Allatostatin | Callatostatin-4 | 8460157#Duve H., Johnsen A.H., Scott A.G., Yu C.G., Yagi K.J., Tobe S.S., Thorpe A.; #Callatostatins: neuropeptides from the blowfly Calliphora vomitoria with sequence homology to cockroach allatostatins.; #Proc. Natl. Acad. Sci. U.S.A. 90:2456-2460(1993). | |
| NP00518 | GPPYDFGM |
8 | Calliphora vomitoria | Allatostatin | Callatostatin-5 | 8460157#Duve H., Johnsen A.H., Scott A.G., Yu C.G., Yagi K.J., Tobe S.S., Thorpe A.; #Callatostatins: neuropeptides from the blowfly Calliphora vomitoria with sequence homology to cockroach allatostatins.; #Proc. Natl. Acad. Sci. U.S.A. 90:2456-2460(1993). | |
| NP00519 | APQPYAFGL |
9 | Carcinus maenas | Allatostatin | Carcinustatin-10 | 9461295#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Jaros P.P., Thorpe A.; #Isolation and identification of multiple neuropeptides of the allatostatin superfamily in the shore crab Carcinus maenas.; #Eur. J. Biochem. 250:727-734(1997). | |
| NP00520 | ATGQYAFGL |
9 | Carcinus maenas | Allatostatin | Carcinustatin-11 | 9461295#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Jaros P.P., Thorpe A.; #Isolation and identification of multiple neuropeptides of the allatostatin superfamily in the shore crab Carcinus maenas.; #Eur. J. Biochem. 250:727-734(1997). | |
| NP00521 | PDMYAFGL |
8 | Carcinus maenas | Allatostatin | Carcinustatin-12 | 9461295#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Jaros P.P., Thorpe A.; #Isolation and identification of multiple neuropeptides of the allatostatin superfamily in the shore crab Carcinus maenas.; #Eur. J. Biochem. 250:727-734(1997). | |
| NP00522 | EYDDMYTEKRPKVYAFGL |
18 | Carcinus maenas | Allatostatin | Carcinustatin-13 | 9461295#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Jaros P.P., Thorpe A.; #Isolation and identification of multiple neuropeptides of the allatostatin superfamily in the shore crab Carcinus maenas.; #Eur. J. Biochem. 250:727-734(1997). | |
| NP00523 | YSFGL |
5 | Carcinus maenas | Allatostatin | Carcinustatin-14 | 9461295#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Jaros P.P., Thorpe A.; #Isolation and identification of multiple neuropeptides of the allatostatin superfamily in the shore crab Carcinus maenas.; #Eur. J. Biochem. 250:727-734(1997). | |
| NP00524 | AGPYSFGL |
8 | Carcinus maenas | Allatostatin | Carcinustatin-15 | 9461295#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Jaros P.P., Thorpe A.; #Isolation and identification of multiple neuropeptides of the allatostatin superfamily in the shore crab Carcinus maenas.; #Eur. J. Biochem. 250:727-734(1997). | |
| NP00525 | GGPYSYGL |
8 | Carcinus maenas | Allatostatin | Carcinustatin-16 | 9461295#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Jaros P.P., Thorpe A.; #Isolation and identification of multiple neuropeptides of the allatostatin superfamily in the shore crab Carcinus maenas.; #Eur. J. Biochem. 250:727-734(1997). | |
| NP00526 | SGQYSFGL |
8 | Carcinus maenas | Allatostatin | Carcinustatin-17 | 9461295#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Jaros P.P., Thorpe A.; #Isolation and identification of multiple neuropeptides of the allatostatin superfamily in the shore crab Carcinus maenas.; #Eur. J. Biochem. 250:727-734(1997). | |
| NP00527 | SDMYSFGL |
8 | Carcinus maenas | Allatostatin | Carcinustatin-18 | 9461295#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Jaros P.P., Thorpe A.; #Isolation and identification of multiple neuropeptides of the allatostatin superfamily in the shore crab Carcinus maenas.; #Eur. J. Biochem. 250:727-734(1997). | |
| NP00528 | APTDMYSFGL |
10 | Carcinus maenas | Allatostatin | Carcinustatin-19 | 9461295#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Jaros P.P., Thorpe A.; #Isolation and identification of multiple neuropeptides of the allatostatin superfamily in the shore crab Carcinus maenas.; #Eur. J. Biochem. 250:727-734(1997). | |
| NP00529 | EAYAFGL |
7 | Carcinus maenas | Allatostatin | Carcinustatin-2 | 9461295#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Jaros P.P., Thorpe A.; #Isolation and identification of multiple neuropeptides of the allatostatin superfamily in the shore crab Carcinus maenas.; #Eur. J. Biochem. 250:727-734(1997). | |
| NP00530 | GYEDEDEDRPFYALGLGKRPRTYSFGL |
27 | Carcinus maenas | Allatostatin | Carcinustatin-20 | 9461295#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Jaros P.P., Thorpe A.; #Isolation and identification of multiple neuropeptides of the allatostatin superfamily in the shore crab Carcinus maenas.; #Eur. J. Biochem. 250:727-734(1997). | |
| NP00531 | EPYAFGL |
7 | Carcinus maenas | Allatostatin | Carcinustatin-3 | 9461295#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Jaros P.P., Thorpe A.; #Isolation and identification of multiple neuropeptides of the allatostatin superfamily in the shore crab Carcinus maenas.; #Eur. J. Biochem. 250:727-734(1997). | |
| NP00532 | DPYAFGL |
7 | Carcinus maenas | Allatostatin | Carcinustatin-4 | 9461295#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Jaros P.P., Thorpe A.; #Isolation and identification of multiple neuropeptides of the allatostatin superfamily in the shore crab Carcinus maenas.; #Eur. J. Biochem. 250:727-734(1997). | |
| NP00533 | NPYAFGL |
7 | Carcinus maenas | Allatostatin | Carcinustatin-5 | 9461295#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Jaros P.P., Thorpe A.; #Isolation and identification of multiple neuropeptides of the allatostatin superfamily in the shore crab Carcinus maenas.; #Eur. J. Biochem. 250:727-734(1997). | |
| NP00534 | YAFGL |
5 | Carcinus maenas | Allatostatin | Carcinustatin-1 | 9461295#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Jaros P.P., Thorpe A.; #Isolation and identification of multiple neuropeptides of the allatostatin superfamily in the shore crab Carcinus maenas.; #Eur. J. Biochem. 250:727-734(1997). | |
| NP00535 | SPYAFGL |
7 | Carcinus maenas | Allatostatin | Carcinustatin-6 | 9461295#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Jaros P.P., Thorpe A.; #Isolation and identification of multiple neuropeptides of the allatostatin superfamily in the shore crab Carcinus maenas.; #Eur. J. Biochem. 250:727-734(1997). | |
| NP00536 | ASPYAFGL |
8 | Carcinus maenas | Allatostatin | Carcinustatin-7 | 9461295#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Jaros P.P., Thorpe A.; #Isolation and identification of multiple neuropeptides of the allatostatin superfamily in the shore crab Carcinus maenas.; #Eur. J. Biochem. 250:727-734(1997). | |
| NP00537 | AGPYAFGL |
8 | Carcinus maenas | Allatostatin | Carcinustatin-8 | 9461295#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Jaros P.P., Thorpe A.; #Isolation and identification of multiple neuropeptides of the allatostatin superfamily in the shore crab Carcinus maenas.; #Eur. J. Biochem. 250:727-734(1997). | |
| NP00538 | GGPYAFGL |
8 | Carcinus maenas | Allatostatin | Carcinustatin-9 | 9461295#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Jaros P.P., Thorpe A.; #Isolation and identification of multiple neuropeptides of the allatostatin superfamily in the shore crab Carcinus maenas.; #Eur. J. Biochem. 250:727-734(1997). | |
| NP00539 | SPHYNFGL |
8 | Cydia pomonella | Allatostatin | Cydiastatin-1 | 9392829#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Winstanley D., Davey M., East P.D., Thorpe A.; #Lepidopteran peptides of the allatostatin superfamily.; #Peptides 18:1301-1309(1997). | |
| NP00540 | AYSYVSEYKRLPVYNFGL |
18 | Cydia pomonella | Allatostatin | Cydiastatin-2 | 9392829#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Winstanley D., Davey M., East P.D., Thorpe A.; #Lepidopteran peptides of the allatostatin superfamily.; #Peptides 18:1301-1309(1997). | |
| NP00541 | SRPYSFGL |
8 | Cydia pomonella | Allatostatin | Cydiastatin-3 | 9392829#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Winstanley D., Davey M., East P.D., Thorpe A.; #Lepidopteran peptides of the allatostatin superfamily.; #Peptides 18:1301-1309(1997). | |
| NP00542 | ARPYSFGL |
8 | Cydia pomonella | Allatostatin | Cydiastatin-4 | 9392829#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Winstanley D., Davey M., East P.D., Thorpe A.; #Lepidopteran peptides of the allatostatin superfamily.; #Peptides 18:1301-1309(1997). | |
| NP00543 | ARGYDFGL |
8 | Cydia pomonella | Allatostatin | Cydiastatin-5 | 9392829#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Winstanley D., Davey M., East P.D., Thorpe A.; #Lepidopteran peptides of the allatostatin superfamily.; #Peptides 18:1301-1309(1997). | |
| NP00544 | LPLYNFGL |
8 | Cydia pomonella | Allatostatin | Cydiastatin-6 | 9392829#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Winstanley D., Davey M., East P.D., Thorpe A.; #Lepidopteran peptides of the allatostatin superfamily.; #Peptides 18:1301-1309(1997). | |
| NP00545 | KMYDFGL |
7 | Cydia pomonella | Allatostatin | Cydiastatin-7 | 9392829#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Winstanley D., Davey M., East P.D., Thorpe A.; #Lepidopteran peptides of the allatostatin superfamily.; #Peptides 18:1301-1309(1997). | |
| NP00546 | ARPYSFGL |
8 | Delia radicum | Allatostatin | Allatostatin-A1 | 20869420#Audsley N., Matthews H.J., Down R.E., Weaver R.J.; #Neuropeptides associated with the central nervous system of the cabbage root fly, Delia radicum (L).; #Peptides 32:434-440(2011).$22848525#Zoephel J., Reiher W., Rexer K.-H., Kahnt J., Wegener C.; #"Peptidomics of the agriculturally damaging larval stage of the cabbage root fly Delia radicum (Diptera: Anthomyiidae)."; #PLoS ONE 7:E41543-E41543(2012). | |
| NP00547 | NRPYSFGL |
8 | Delia radicum | Allatostatin | Allatostatin-A2 | 20869420#Audsley N., Matthews H.J., Down R.E., Weaver R.J.; #Neuropeptides associated with the central nervous system of the cabbage root fly, Delia radicum (L).; #Peptides 32:434-440(2011).$22848525#Zoephel J., Reiher W., Rexer K.-H., Kahnt J., Wegener C.; #"Peptidomics of the agriculturally damaging larval stage of the cabbage root fly Delia radicum (Diptera: Anthomyiidae)."; #PLoS ONE 7:E41543-E41543(2012). | |
| NP00548 | VERYAFGL |
8 | Delia radicum | Allatostatin | Allatostatin-A3 | 20869420#Audsley N., Matthews H.J., Down R.E., Weaver R.J.; #Neuropeptides associated with the central nervous system of the cabbage root fly, Delia radicum (L).; #Peptides 32:434-440(2011).$22848525#Zoephel J., Reiher W., Rexer K.-H., Kahnt J., Wegener C.; #"Peptidomics of the agriculturally damaging larval stage of the cabbage root fly Delia radicum (Diptera: Anthomyiidae)."; #PLoS ONE 7:E41543-E41543(2012). | |
| NP00549 | LPVYNFGL |
8 | Delia radicum | Allatostatin | Allatostatin-A4 | 20869420#Audsley N., Matthews H.J., Down R.E., Weaver R.J.; #Neuropeptides associated with the central nervous system of the cabbage root fly, Delia radicum (L).; #Peptides 32:434-440(2011).$22848525#Zoephel J., Reiher W., Rexer K.-H., Kahnt J., Wegener C.; #"Peptidomics of the agriculturally damaging larval stage of the cabbage root fly Delia radicum (Diptera: Anthomyiidae)."; #PLoS ONE 7:E41543-E41543(2012). | |
| NP00550 | QVRYRQCYFNPISCF |
15 | Delia radicum | Allatostatin | Allatostatin-C1 | 22848525#Zoephel J., Reiher W., Rexer K.-H., Kahnt J., Wegener C.; #Peptidomics of the agriculturally damaging larval stage of the cabbage root fly Delia radicum (Diptera: Anthomyiidae).; #PLoS ONE 7:E41543-E41543(2012). | |
| NP00551 | LYDFGL |
6 | Diploptera punctata | Allatostatin | Allatostatin-1 | ||
| NP00552 | PVNSGRSSGSRFNFGL |
16 | Diploptera punctata | Allatostatin | Allatostatin-10 | ||
| NP00553 | YPQEHRFSFGL |
11 | Diploptera punctata | Allatostatin | Allatostatin-11 | ||
| NP00554 | PFNFGL |
6 | Diploptera punctata | Allatostatin | Allatostatin-12 | ||
| NP00555 | IPMYDFGI |
8 | Diploptera punctata | Allatostatin | Allatostatin-13 | ||
| NP00556 | AYSYVSEYKRLPVYNFGL |
18 | Diploptera punctata | Allatostatin | Allatostatin-2 | 2006179#Pratt G.E., Farnsworth D.E., Fok K.F., Siegel N.R., McCormack A.L., Shabanowitz J., Hunt D.F., Feyereisen R.; #Identity of a second type of allatostatin from cockroach brains: an octadecapeptide amide with a tyrosine-rich address sequence.; #Proc. Natl. Acad. Sci. U.S.A. 88:2412-2416(1991). | |
| NP00557 | SKMYGFGL |
8 | Diploptera punctata | Allatostatin | Allatostatin-3 | ||
| NP00558 | DGRMYSFGL |
9 | Diploptera punctata | Allatostatin | Allatostatin-4 | ||
| NP00559 | DRLYSFGL |
8 | Diploptera punctata | Allatostatin | Allatostatin-5 | 2762309#Woodhead A.P., Stay B., Seidel S.L., Khan M.A., Tobe S.S.; #Primary structure of four allatostatins: neuropeptide inhibitors of juvenile hormone synthesis.; #Proc. Natl. Acad. Sci. U.S.A. 86:5997-6001(1989). | |
| NP00560 | ARPYSFGL |
8 | Diploptera punctata | Allatostatin | Allatostatin-6 | ||
| NP00561 | APSGAQRLYGFGL |
13 | Diploptera punctata | Allatostatin | Allatostatin-7 | 2762309# Woodhead A.P., Stay B., Seidel S.L., Khan M.A., Tobe S.S.; #Primary structure of four allatostatins: neuropeptide inhibitors of juvenile hormone synthesis.; # Proc. Natl. Acad. Sci. U.S.A. 86:5997-6001(1989).$2783135#Pratt G.E., Farnsworth D.E., Siegel N.R., Fok K.F., Feyereisen R.; #Identification of an allatostatin from adult Diploptera punctata.; #Biochem. Biophys. Res. Commun. 163:1243-1247(1989). | |
| NP00562 | GGSLYSFGL |
9 | Diploptera punctata | Allatostatin | Allatostatin-8 | 2762309#Woodhead A.P., Stay B., Seidel S.L., Khan M.A., Tobe S.S.; #Primary structure of four allatostatins: neuropeptide inhibitors of juvenile hormone synthesis.; #Proc. Natl. Acad. Sci. U.S.A. 86:5997-6001(1989). | |
| NP00563 | GDGRLYAFGL |
10 | Diploptera punctata | Allatostatin | Allatostatin-9 | 2762309#Woodhead A.P., Stay B., Seidel S.L., Khan M.A., Tobe S.S.; #Primary structure of four allatostatins: neuropeptide inhibitors of juvenile hormone synthesis.; #Proc. Natl. Acad. Sci. U.S.A. 86:5997-6001(1989). | |
| NP00564 | VERYAFGL |
8 | Drosophila melanogaster | Allatostatin | Drostatin-1 (Potential) | ||
| NP00565 | LPVYNFGL |
8 | Drosophila melanogaster | Allatostatin | Drostatin-2 (Potential) | ||
| NP00566 | SRPYSFGL |
8 | Drosophila melanogaster | Allatostatin | Drostatin-3 | 12171930#Baggerman G., Cerstiaens A., De Loof A., Schoofs L.; #Peptidomics of the larval Drosophila melanogaster central nervous system.; #J. Biol. Chem. 277:40368-40374(2002). | |
| NP00567 | TTRPQPFNFGL |
11 | Drosophila melanogaster | Allatostatin | Drostatin-4 | 12171930#Baggerman G., Cerstiaens A., De Loof A., Schoofs L.; #Peptidomics of the larval Drosophila melanogaster central nervous system.; #J. Biol. Chem. 277:40368-40374(2002). | |
| NP00568 | AYMYTNGGPGM |
11 | Drosophila melanogaster | Allatostatin | Drostatin-5 | 12171930#Baggerman G., Cerstiaens A., De Loof A., Schoofs L.; #Peptidomics of the larval Drosophila melanogaster central nervous system.; #J. Biol. Chem. 277:40368-40374(2002). | |
| NP00569 | AWQSLQSSW |
9 | Drosophila melanogaster | Allatostatin | Drostatin-B1 (Potential) | ||
| NP00570 | AWKSMNVAW |
9 | Drosophila melanogaster | Allatostatin | Drostatin-B2 | 12171930#Baggerman G., Cerstiaens A., De Loof A., Schoofs L.; #Peptidomics of the larval Drosophila melanogaster central nervous system.; #J. Biol. Chem. 277:40368-40374(2002). | |
| NP00571 | RQAQGWNKFRGAW |
13 | Drosophila melanogaster | Allatostatin | Drostatin-B3 (Potential) | 20575072#Carlsson MA, Diesner M, Schachtner J, Nässel DR#Multiple neuropeptides in the Drosophila antennal lobe suggest complex modulatory circuits#J Comp Neurol 2010 Aug 15;518(16):3359-80 | |
| NP00572 | EPTWNNLKGMW |
11 | Drosophila melanogaster | Allatostatin | Drostatin-B4 (Potential) | ||
| NP00573 | DQWQKLHGGW |
10 | Drosophila melanogaster | Allatostatin | Drostatin-B5 | 12171930#Baggerman G., Cerstiaens A., De Loof A., Schoofs L.; #Peptidomics of the larval Drosophila melanogaster central nervous system.; #J. Biol. Chem. 277:40368-40374(2002).$20575072#Carlsson MA, Diesner M, Schachtner J, Nässel DR#Multiple neuropeptides in the Drosophila antennal lobe suggest complex modulatory circuits#J Comp Neurol 2010 Aug 15;518(16):3359-80 | |
| NP00574 | SPHYDFGL |
8 | Helicoverpa armigera | Allatostatin | Helicostatin-1 | 9392829#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Winstanley D., Davey M., East P.D., Thorpe A.; #Lepidopteran peptides of the allatostatin superfamily.; #Peptides 18:1301-1309(1997). | |
| NP00575 | AYSYVSEYKRLPVYNFGL |
18 | Helicoverpa armigera | Allatostatin | Helicostatin-2a | 9392829#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Winstanley D., Davey M., East P.D., Thorpe A.; #Lepidopteran peptides of the allatostatin superfamily.; #Peptides 18:1301-1309(1997). | |
| NP00576 | LPVYNFGL |
8 | Helicoverpa armigera | Allatostatin | Helicostatin-2b | ||
| NP00577 | SRPYSFGL |
8 | Helicoverpa armigera | Allatostatin | Helicostatin-3 | 9392829#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Winstanley D., Davey M., East P.D., Thorpe A.; #Lepidopteran peptides of the allatostatin superfamily.; #Peptides 18:1301-1309(1997). | |
| NP00578 | ARPYSFGL |
8 | Helicoverpa armigera | Allatostatin | Helicostatin-4 | 9392829#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Winstanley D., Davey M., East P.D., Thorpe A.; #Lepidopteran peptides of the allatostatin superfamily.; #Peptides 18:1301-1309(1997). | |
| NP00579 | ARAYDFGL |
8 | Helicoverpa armigera | Allatostatin | Helicostatin-5 | 9392829#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Winstanley D., Davey M., East P.D., Thorpe A.; #Lepidopteran peptides of the allatostatin superfamily.; #Peptides 18:1301-1309(1997). | |
| NP00580 | LPMYNFGL |
8 | Helicoverpa armigera | Allatostatin | Helicostatin-6 | 9392829#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Winstanley D., Davey M., East P.D., Thorpe A.; #Lepidopteran peptides of the allatostatin superfamily.; #Peptides 18:1301-1309(1997). | |
| NP00581 | ARSYNFGL |
8 | Helicoverpa armigera | Allatostatin | Helicostatin-7 | 9392829#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Winstanley D., Davey M., East P.D., Thorpe A.; #Lepidopteran peptides of the allatostatin superfamily.; #Peptides 18:1301-1309(1997). | |
| NP00582 | YSKFNFGL |
8 | Helicoverpa armigera | Allatostatin | Helicostatin-8 | 9392829#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Winstanley D., Davey M., East P.D., Thorpe A.; #Lepidopteran peptides of the allatostatin superfamily.; #Peptides 18:1301-1309(1997). | |
| NP00583 | ERDMHRFSFGL |
11 | Helicoverpa armigera | Allatostatin | Helicostatin-9 | 9392829#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Winstanley D., Davey M., East P.D., Thorpe A.; #Lepidopteran peptides of the allatostatin superfamily.; #Peptides 18:1301-1309(1997). | |
| NP00584 | AWQDLNAGW |
9 | Locusta migratoria | Allatostatin | Locustamyoinhibiting peptide | 1796179#Schoofs L., Holman G.M., Hayes T.K., Nachman R.J., de Loof A.; #Isolation, identification and synthesis of locustamyoinhibiting peptide (LOM-MIP), a novel biologically active neuropeptide from Locusta migratoria.; #Regul. Pept. 36:111-119(1991). | |
| NP00585 | QVRFRQCYFNPISCF |
15 | Manduca sexta | Allatostatin | Allatostatin | 1946359#Kramer S.J., Toschi A., Miller C.A., Kataoka H., Quistad G.B., Li J.P., Carney R.L., Schooley D.A.; #Identification of an allatostatin from the tobacco hornworm Manduca sexta.; #Proc. Natl. Acad. Sci. U.S.A. 88:9458-9462(1991). | |
| NP00586 | LPVYNFGL |
8 | Rhodnius prolixus | Allatostatin | Allatostatin-1 | 19137558#Ons S., Richter F., Urlaub H., Pomar R.R.; #The neuropeptidome of Rhodnius prolixus brain.; #Proteomics 9:788-792(2009). | |
| NP00587 | MRNYSFGL |
8 | Rhodnius prolixus | Allatostatin | Allatostatin-2 | 19137558#Ons S., Richter F., Urlaub H., Pomar R.R.; #The neuropeptidome of Rhodnius prolixus brain.; #Proteomics 9:788-792(2009). | |
| NP00588 | QVSLKYPEGKMYSFGL |
16 | Rhodnius prolixus | Allatostatin | Allatostatin-3 | 19137558#Ons S., Richter F., Urlaub H., Pomar R.R.; #The neuropeptidome of Rhodnius prolixus brain.; #Proteomics 9:788-792(2009). | |
| NP00589 | QVRFRQCYFNPISCF |
15 | Spodoptera frugiperda | Allatostatin | Allatostatin (By similarity) | ||
| NP00590 | SYWKQCAFNAVSCF |
14 | Apis mellifera | Allatostatin | Allatostatin C | 19576913#Boerjan B, Cardoen D, Bogaerts A, Landuyt B, Schoofs L, Verleyen P#Mass spectrometric profiling of (neuro)-peptides in the worker honeybee, Apis mellifera#Neuropharmacology 2010 Jan;58(1):248-58 $17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J.,Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L.,Robinson G.E., Sweedler J.V.#From the genome to the proteome: uncovering peptides in the Apis brain.#Science 314:647-649(2006). | |
| NP00591 | LRNQLDIGDL |
10 | Apis mellifera | Allatostatin | LRNQLDIGDLQ–allatostatinC | 19576913#Boerjan B, Cardoen D, Bogaerts A, Landuyt B, Schoofs L, Verleyen P#Mass spectrometric profiling of (neuro)-peptides in the worker honeybee, Apis mellifera#Neuropharmacology 2010 Jan;58(1):248-58 $17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J.,Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L.,Robinson G.E., Sweedler J.V.#From the genome to the proteome: uncovering peptides in the Apis brain.#Science 314:647-649(2006). | |
| NP00592 | LRNQLDIGDLQ |
11 | Apis mellifera | Allatostatin | LRNQLDIGDLQ–allatostatinC | 19576913#Boerjan B, Cardoen D, Bogaerts A, Landuyt B, Schoofs L, Verleyen P#Mass spectrometric profiling of (neuro)-peptides in the worker honeybee, Apis mellifera#Neuropharmacology 2010 Jan;58(1):248-58 $17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J.,Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L.,Robinson G.E., Sweedler J.V.#From the genome to the proteome: uncovering peptides in the Apis brain.#Science 314:647-649(2006). | |
| NP00593 | AQHQYSFGL |
9 | Gryllus bimaculatus | Allatostatin | Allatostatin 1 | 7673141#Lorenz MW, Kellner R, Hoffmann KH#A family of neuropeptides that inhibit juvenile hormone biosynthesis in the cricket, Gryllus bimaculatus#J Biol Chem 1995 Sep 8;270(36):21103-8 | |
| NP00594 | AGGRQYGFGL |
10 | Gryllus bimaculatus | Allatostatin | Allatostatin-2 | 7673141#Lorenz MW, Kellner R, Hoffmann KH#A family of neuropeptides that inhibit juvenile hormone biosynthesis in the cricket, Gryllus bimaculatus#J Biol Chem 1995 Sep 8;270(36):21103-8 | |
| NP00595 | NYWRQCAFNAVSCF |
14 | Nasonia vitripennis | Allatostatin | Allatostatin-C | 20695486#Hauser F, Neupert S, Williamson M, Predel R, Tanaka Y, Grimmelikhuijzen CJ#Genomics and peptidomics of neuropeptides and protein hormones present in the parasitic wasp Nasonia vitripennis#J Proteome Res 2010 Oct 1;9(10):5296-310 | |
| NP00596 | GQAKGRVYWRCYFNAVTCF |
19 | Nasonia vitripennis | Allatostatin | Allatostatin-CC | 20695486#Hauser F, Neupert S, Williamson M, Predel R, Tanaka Y, Grimmelikhuijzen CJ#Genomics and peptidomics of neuropeptides and protein hormones present in the parasitic wasp Nasonia vitripennis#J Proteome Res 2010 Oct 1;9(10):5296-310 |