Neuropeptide Database

Total number of results for Allatostatin are 361

Download as Fasta All

NPID	Sequence	Length	Organism	Family	Name	Peptide_REF
NP00236	SRPYSFGL	8	Aedes aegypti	Allatostatin	Allatostatin	9357049#Veenstra JA, Noriega FG, Graf R, Feyereisen R#Identification of three allatostatins and their cDNA from the mosquito Aedes aegypti#Peptides 1997;18(7):937-42
NP00237	GEGKMFWRCYFNAVSCF	17	Amblyomma variegatum	Allatostatin	Allatostatin CC peptide	20888826#Christie AE, Nolan DH, Ohno P, Hartline N, Lenz PH#Identification of chelicerate neuropeptides using bioinformatics of publicly accessible expressed sequence tags#Gen Comp Endocrinol 2011 Jan 1;170(1):144-55
NP00238	GDGRLYAFGL	10	Ascaris suum	Allatostatin	Allatostatin A	16185693#Mousley A, Moffett CL, Duve H, Thorpe A, Halton DW, Geary TG, Thompson DP, Maule AG, Marks NJ#Expression and bioactivity of allatostatin-like neuropeptides in helminths#Int J Parasitol 2005 Dec;35(14):1557-67
NP00239	LYDFGL	6	Blattella germanica	Allatostatin	Allatostatin-1	7846299#Bellés X, Maestro JL, Piulachs MD, Johnsen AH, Duve H, Thorpe A#Allatostatic neuropeptides from the cockroach Blattella germanica (L#) (Dictyoptera, Blattellidae) Identification, immunolocalization and activity Regul Pept 1994 Oct 21;53(3):237-47
NP00240	DRLYSFGL	8	Blattella germanica	Allatostatin	BLAST-2	9474781#Piulachs MD, Vilaplana L, Bartolomé JM, Carreño C, Martín D, González-Muñiz R, Herranz R, García-López MT, Andreu D, Bellés X#Ketomethylene and methyleneamino pseudopeptide analogues of insect allatostatins inhibit juvenile hormone and vitellogenin production in the cockroach Blattella germanica#Insect Biochem Mol Biol 1997 Oct;27(10):851-8
NP00241	AGSDGRLYSFGL	12	Blattella germanica	Allatostatin	BLAST-3	7846299#Bellés X, Maestro JL, Piulachs MD, Johnsen AH, Duve H, Thorpe A#Allatostatic neuropeptides from the cockroach Blattella germanica (L) (Dictyoptera, Blattellidae) Identification, immunolocalization and activity #Regul Pept 1994 Oct 21;53(3):237-47
NP00242	APSSAQRLYGFGL	13	Blattella germanica	Allatostatin	BLAST-4	7846299#Bellés X, Maestro JL, Piulachs MD, Johnsen AH, Duve H, Thorpe A#Allatostatic neuropeptides from the cockroach Blattella germanica (L#) (Dictyoptera, Blattellidae) Identification, immunolocalization and activity Regul Pept 1994 Oct 21;53(3):237-47
NP00243	APYGFGI	7	Calanus finmarchicus	Allatostatin	Allatostatin A	17950732#Christie AE, Sousa GL, Rus S, Smith CM, Towle DW, Hartline DK, Dickinson PS#Identification of A-type allatostatins possessing -YXFGI/Vamide carboxy-termini from the nervous system of the copepod crustacean Calanus finmarchicus#Gen Comp Endocrinol 2008 Feb 1;155(3):526-33
NP00244	EPYGFGI	7	Calanus finmarchicus	Allatostatin	Allatostatin A	17950732#Christie AE, Sousa GL, Rus S, Smith CM, Towle DW, Hartline DK, Dickinson PS#Identification of A-type allatostatins possessing -YXFGI/Vamide carboxy-termini from the nervous system of the copepod crustacean Calanus finmarchicus#Gen Comp Endocrinol 2008 Feb 1;155(3):526-33
NP00245	GPXYDFGM	8	Calliphora vomitoria	Allatostatin	[HYP3]Met-callatostatin	8063725#Duve H, Johnsen AH, Scott AG, East P, Thorpe A#[Hyp3]Met-callatostatin#Identification and biological properties of a novel neuropeptide from the blowfly Calliphora vomitoria J Biol Chem 1994 Aug 19;269(33):21059-66
NP00246	XRPYSFGL	8	Calliphora vomitoria	Allatostatin	Callatostatin 4	8460157#Duve H, Johnsen AH, Scott AG, Yu CG, Yagi KJ, Tobe SS, Thorpe A#Callatostatins: neuropeptides from the blowfly Calliphora vomitoria with sequence homology to cockroach allatostatins#Proc Natl Acad Sci U S A 1993 Mar 15;90(6):2456-60
NP00247	LPVYNFGL	8	Calliphora vomitoria	Allatostatin	Leu-callatostatin	8952000#Duve H, Johnsen AH, Maestro JL, Scott AG, East PD, Thorpe A#Identification of the dipteran Leu-callatostatin peptide family: the pattern of precursor processing revealed by isolation studies in Calliphora vomitoria#Regul Pept 1996 Nov 14;67(1):11-9
NP00248	NRPYSFGL	8	Calliphora vomitoria	Allatostatin	Leu-callatostatin	8952000#Duve H, Johnsen AH, Maestro JL, Scott AG, East PD, Thorpe A#Identification of the dipteran Leu-callatostatin peptide family: the pattern of precursor processing revealed by isolation studies in Calliphora vomitoria#Regul Pept 1996 Nov 14;67(1):11-9
NP00249	PYDFGM	6	Calliphora vomitoria	Allatostatin	Met-callatostatin	7480873#Duve H, Johnsen AH, Scott AG, Thorpe A#Isolation, identification and functional significance of [Hyp2]Met-callatostatin and des Gly-Pro Met-callatostatin, two further post-translational modifications of the blowfly neuropeptide Met-callatostatin#Regul Pept 1995 Jun 27;57(3):237-45
NP00250	QIRYHQCYFNPISCF	15	Cancer borealis	Allatostatin	Allatostatin C	19505516#Ma M, Szabo TM, Jia C, Marder E, Li L#Mass spectrometric characterization and physiological actions of novel crustacean C-type allatostatins#Peptides 2009 Sep;30(9):1660-8
NP00251	SYWKQCAFNAVSCF	14	Cancer borealis	Allatostatin	Allatostatin C	19505516#Ma M, Szabo TM, Jia C, Marder E, Li L#Mass spectrometric characterization and physiological actions of novel crustacean C-type allatostatins#Peptides 2009 Sep;30(9):1660-8
NP00252	LPVYNFGL	8	Cydia pomonella	Allatostatin	Leu-callatostatin	9182602#Duve H, Johnsen AH, Maestro JL, Scott AG, Crook N, Winstanley D, Thorpe A#Identification, tissue localisation and physiological effect in vitro of a neuroendocrine peptide identical to a dipteran Leu-callatostatin in the codling moth Cydia pomonella (Tortricidae: Lepidoptera)#Cell Tissue Res 1997 Jul;289(1):73-83
NP00253	EVRYRQCYFNPISCF	15	Drosophila melanogaster	Allatostatin	Allatostatin C	12479379#Kaminski S, Orlowski E, Berry K, Nichols R#The effects of three Drosophila melanogaster myotropins on the frequency of foregut contractions differ#J Neurogenet 2002 Apr-Jun;16(2):125-34
NP00254	GEGKMFWRCYFNAVSCF	17	Mesobuthus gibbosus	Allatostatin	Allatostatin CC peptide	20888826#Christie AE, Nolan DH, Ohno P, Hartline N, Lenz PH#Identification of chelicerate neuropeptides using bioinformatics of publicly accessible expressed sequence tags#Gen Comp Endocrinol 2011 Jan 1;170(1):144-55
NP00255	PRVYGFGL	8	Orconectes limosus	Allatostatin	Allatostatin A	10477125#Dircksen H, Skiebe P, Abel B, Agricola H, Buchner K, Muren JE, Nässel DR#Structure, distribution, and biological activity of novel members of the allatostatin family in the crayfish Orconectes limosus#Peptides 1999;20(6):695-712
NP00256	AGPYAFGL	8	Orconectes limosus	Allatostatin	Carcinustatin-8	10477125#Dircksen H, Skiebe P, Abel B, Agricola H, Buchner K, Muren JE, Nässel DR#Structure, distribution, and biological activity of novel members of the allatostatin family in the crayfish Orconectes limosus#Peptides 1999;20(6):695-712
NP00257	SAGPYAFGL	9	Orconectes limosus	Allatostatin	orcostatin I	10477125#Dircksen H, Skiebe P, Abel B, Agricola H, Buchner K, Muren JE, Nässel DR#Structure, distribution, and biological activity of novel members of the allatostatin family in the crayfish Orconectes limosus#Peptides 1999;20(6):695-712
NP00258	ANQYTFGL	8	Penaeus monodon	Allatostatin	Allatostatin	12126730#Duve H, Johnsen AH, Scott AG, Thorpe A#Allatostatins of the tiger prawn, Penaeus monodon (Crustacea: Penaeidea)#Peptides 2002 Jun;23(6):1039-51
NP00259	ASQYTFGL	8	Penaeus monodon	Allatostatin	Allatostatin	12126730#Duve H, Johnsen AH, Scott AG, Thorpe A#Allatostatins of the tiger prawn, Penaeus monodon (Crustacea: Penaeidea)#Peptides 2002 Jun;23(6):1039-51
NP00260	ATGAASLYSFGL	12	Schistocerca gregaria	Allatostatin	Allatostatin 3	8902848#Veelaert D, Devreese B, Schoofs L, Van Beeumen J, Vanden Broeck J, Tobe SS, De Loof A#Isolation and characterization of eight myoinhibiting peptides from the desert locust, Schistocerca gregaria: new members of the cockroach allatostatin family#Mol Cell Endocrinol 1996 Sep 18;122(2):183-90
NP00261	AYTYVSEYKRLPVYNFGL	18	Schistocerca gregaria	Allatostatin	Allatostatin-2	8902848#Veelaert D, Devreese B, Schoofs L, Van Beeumen J, Vanden Broeck J, Tobe SS, De Loof A#Isolation and characterization of eight myoinhibiting peptides from the desert locust, Schistocerca gregaria: new members of the cockroach allatostatin family#Mol Cell Endocrinol 1996 Sep 18;122(2):183-90
NP00262	ARPYSFGL	8	Schistocerca gregaria	Allatostatin	Allatostatin-6	8902848#Veelaert D, Devreese B, Schoofs L, Van Beeumen J, Vanden Broeck J, Tobe SS, De Loof A#Isolation and characterization of eight myoinhibiting peptides from the desert locust, Schistocerca gregaria: new members of the cockroach allatostatin family#Mol Cell Endocrinol 1996 Sep 18;122(2):183-90
NP00263	APAEHRFSFGL	11	Schistocerca gregaria	Allatostatin	Scg-AST-10	8902848#Veelaert D, Devreese B, Schoofs L, Van Beeumen J, Vanden Broeck J, Tobe SS, De Loof A#Isolation and characterization of eight myoinhibiting peptides from the desert locust, Schistocerca gregaria: new members of the cockroach allatostatin family#Mol Cell Endocrinol 1996 Sep 18;122(2):183-90
NP00264	GPRTYSFGL	9	Schistocerca gregaria	Allatostatin	Scg-AST-4	8902848#Veelaert D, Devreese B, Schoofs L, Van Beeumen J, Vanden Broeck J, Tobe SS, De Loof A#Isolation and characterization of eight myoinhibiting peptides from the desert locust, Schistocerca gregaria: new members of the cockroach allatostatin family#Mol Cell Endocrinol 1996 Sep 18;122(2):183-90
NP00265	GRLYSFGL	8	Schistocerca gregaria	Allatostatin	Scg-AST-5	8902848#Veelaert D, Devreese B, Schoofs L, Van Beeumen J, Vanden Broeck J, Tobe SS, De Loof A#Isolation and characterization of eight myoinhibiting peptides from the desert locust, Schistocerca gregaria: new members of the cockroach allatostatin family#Mol Cell Endocrinol 1996 Sep 18;122(2):183-90
NP00266	AGPAPSRLYSFGL	13	Schistocerca gregaria	Allatostatin	Scg-AST-7	8902848#Veelaert D, Devreese B, Schoofs L, Van Beeumen J, Vanden Broeck J, Tobe SS, De Loof A#Isolation and characterization of eight myoinhibiting peptides from the desert locust, Schistocerca gregaria: new members of the cockroach allatostatin family#Mol Cell Endocrinol 1996 Sep 18;122(2):183-90
NP00267	EGRMYSFGL	9	Schistocerca gregaria	Allatostatin	Scg-AST-8	8902848#Veelaert D, Devreese B, Schoofs L, Van Beeumen J, Vanden Broeck J, Tobe SS, De Loof A#Isolation and characterization of eight myoinhibiting peptides from the desert locust, Schistocerca gregaria: new members of the cockroach allatostatin family#Mol Cell Endocrinol 1996 Sep 18;122(2):183-90
NP00268	ESRYRQCYFNPISCF	15	Tenebrio molitor	Allatostatin	Allatostatin-C	18201799#Weaver RJ, Audsley N#Neuropeptides of the beetle, Tenebrio molitor identified using MALDI-TOF mass spectrometry and deduced sequences from the Tribolium castaneum genome#Peptides 2008 Feb;29(2):168-78
NP00269	QIRYHQCYFNPISCF	15	Tetranychus urticae	Allatostatin	Allatostatin C	20888826#Christie AE, Nolan DH, Ohno P, Hartline N, Lenz PH#Identification of chelicerate neuropeptides using bioinformatics of publicly accessible expressed sequence tags#Gen Comp Endocrinol 2011 Jan 1;170(1):144-55
NP00270	SPKYNFGL	8	Aedes aegypti	Allatostatin	Allatostatin 1	20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15
NP00271	LPHYNFGL	8	Aedes aegypti	Allatostatin	Allatostatin 2	20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15
NP00272	ASAYRYHFGL	10	Aedes aegypti	Allatostatin	Allatostatin 3	20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15
NP00273	QIRYRQCYFNPISCF	15	Aedes aegypti	Allatostatin	Allatostatin C	20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15
NP00274	RVYDFGL	7	Aedes aegypti	Allatostatin	Allatostatin-4	20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15
NP00275	LPNRYNFGL	9	Aedes aegypti	Allatostatin	Allatostatin-5	20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15
NP00276	VYEDKRLPNRYNFGL	15	Aedes aegypti	Allatostatin	AST-5	20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15
NP00277	TWKNLQGGW	9	Aedes aegypti	Allatostatin	MIP-1	20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15
NP00278	AWNKINGGW	9	Aedes aegypti	Allatostatin	MIP-2	20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15
NP00279	VNAGPAQWNKFRGSW	15	Aedes aegypti	Allatostatin	MIP-3	20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15
NP00280	EPGWNNLKGLW	11	Aedes aegypti	Allatostatin	MIP-4b	20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15
NP00281	SEKWNKLSSSW	11	Aedes aegypti	Allatostatin	MIP-5	20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15
NP00282	AYTYVSEYKRLPVYNFGI	18	Apis mellifera	Allatostatin	Allatostatin A	19576913#Boerjan B, Cardoen D, Bogaerts A, Landuyt B, Schoofs L, Verleyen P#Mass spectrometric profiling of (neuro)-peptides in the worker honeybee, Apis mellifera#Neuropharmacology 2010 Jan;58(1):248-58
NP00283	AAGLQNYDFG	10	Callinectes sapidus	Allatostatin	Allatostatin A	22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9
NP00284	AGLSALYSFG	10	Callinectes sapidus	Allatostatin	Allatostatin A	22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9
NP00285	AGPYSFGL	8	Callinectes sapidus	Allatostatin	Allatostatin A	22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9
NP00286	ALTTLYAFGL	10	Callinectes sapidus	Allatostatin	Allatostatin A	22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9
NP00287	APQPYAFGL	9	Callinectes sapidus	Allatostatin	Allatostatin A	22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9
NP00288	APRPYSFGL	9	Callinectes sapidus	Allatostatin	Allatostatin A	22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9
NP00289	ARAYDFGL	8	Callinectes sapidus	Allatostatin	Allatostatin A	22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9
NP00290	ARGYDFGL	8	Callinectes sapidus	Allatostatin	Allatostatin A	22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9
NP00291	ARPYSFGL	8	Callinectes sapidus	Allatostatin	Allatostatin A	22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9
NP00292	ASPYAFGL	8	Callinectes sapidus	Allatostatin	Allatostatin A	22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9
NP00293	DGPYSFGL	8	Callinectes sapidus	Allatostatin	Allatostatin A	22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9
NP00294	DPYAFGL	7	Callinectes sapidus	Allatostatin	Allatostatin A	22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9
NP00295	ERAYSFGL	8	Callinectes sapidus	Allatostatin	Allatostatin A	22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9
NP00296	FSGTYNFGL	9	Callinectes sapidus	Allatostatin	Allatostatin A	22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9
NP00297	GPPYSFGL	8	Callinectes sapidus	Allatostatin	Allatostatin A	22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9
NP00298	GPYSFGL	7	Callinectes sapidus	Allatostatin	Allatostatin A	22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9
NP00299	GSGQYAYGLGKAGQYSFGL	19	Callinectes sapidus	Allatostatin	Allatostatin A	22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9
NP00300	NGSYPFGL	8	Callinectes sapidus	Allatostatin	Allatostatin A	22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9
NP00301	NPYSFGL	7	Callinectes sapidus	Allatostatin	Allatostatin A	22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9
NP00302	NVYSFGL	7	Callinectes sapidus	Allatostatin	Allatostatin A	22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9
NP00303	PRVYSFGL	8	Callinectes sapidus	Allatostatin	Allatostatin A	22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9
NP00304	QWLYSMFGL	9	Callinectes sapidus	Allatostatin	Allatostatin A	22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9
NP00305	RNMYSFGL	8	Callinectes sapidus	Allatostatin	Allatostatin A	22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9
NP00306	SDMYSFGL	8	Callinectes sapidus	Allatostatin	Allatostatin A	22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9
NP00307	SGHYNFGL	8	Callinectes sapidus	Allatostatin	Allatostatin A	22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9
NP00308	SGNYNFGL	8	Callinectes sapidus	Allatostatin	Allatostatin A	22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9
NP00309	SNPYSFGL	8	Callinectes sapidus	Allatostatin	Allatostatin A	22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9
NP00310	SSGQYAFGL	9	Callinectes sapidus	Allatostatin	Allatostatin A	22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9
NP00311	TAPYAFGL	8	Callinectes sapidus	Allatostatin	Allatostatin A	22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9
NP00312	THPTYSFGL	9	Callinectes sapidus	Allatostatin	Allatostatin A	22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9
NP00313	TPQANSFGL	9	Callinectes sapidus	Allatostatin	Allatostatin A	22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9
NP00314	TRPYSFGL	8	Callinectes sapidus	Allatostatin	Allatostatin A	22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9
NP00315	YAFGL	5	Callinectes sapidus	Allatostatin	Allatostatin A	22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9
NP00316	AGWNKFQGSW	10	Callinectes sapidus	Allatostatin	Allatostatin B	22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9
NP00317	AGWSSLKGAW	10	Callinectes sapidus	Allatostatin	Allatostatin B	22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9
NP00318	AGWSSMRGAW	10	Callinectes sapidus	Allatostatin	Allatostatin B	22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9
NP00319	AWSNLQGAW	9	Callinectes sapidus	Allatostatin	Allatostatin B	22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9
NP00320	GNWNKFQGSW	10	Callinectes sapidus	Allatostatin	Allatostatin B	22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9
NP00321	NDWSKFGQSW	10	Callinectes sapidus	Allatostatin	Allatostatin B	22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9
NP00322	NNNWSKFQGSW	11	Callinectes sapidus	Allatostatin	Allatostatin B	22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9
NP00323	NNNWTKFQGSW	11	Callinectes sapidus	Allatostatin	Allatostatin B	22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9
NP00324	NNWSKFQGSW	10	Callinectes sapidus	Allatostatin	Allatostatin B	22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9
NP00325	NWNKFQGSW	9	Callinectes sapidus	Allatostatin	Allatostatin B	22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9
NP00326	SGDWSSLRGAW	11	Callinectes sapidus	Allatostatin	Allatostatin B	22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9
NP00327	SGKWSNLRGAW	11	Callinectes sapidus	Allatostatin	Allatostatin B	22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9
NP00328	STDWSSLRSAW	11	Callinectes sapidus	Allatostatin	Allatostatin B	22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9
NP00329	STNWSSLRSAW	11	Callinectes sapidus	Allatostatin	Allatostatin B	22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9
NP00330	TGWNKFQGSW	10	Callinectes sapidus	Allatostatin	Allatostatin B	22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9
NP00331	TSWGKFQGSW	10	Callinectes sapidus	Allatostatin	Allatostatin B	22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9
NP00332	VPNDWAHFRGSW	12	Callinectes sapidus	Allatostatin	Allatostatin B	22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9
NP00333	DPYAFGL	7	Cancer borealis	Allatostatin	Allatostatin A	18700782#Behrens HL, Chen R, Li L#Combining microdialysis, NanoLC-MS, and MALDI-TOF/TOF to detect neuropeptides secreted in the crab, Cancer borealis#Anal Chem 2008 Sep 15;80(18):6949-58
NP00334	ERAYSFGL	8	Cancer borealis	Allatostatin	Allatostatin A	17381149#DeKeyser SS, Kutz-Naber KK, Schmidt JJ, Barrett-Wilt GA, Li L#Imaging mass spectrometry of neuropeptides in decapod crustacean neuronal tissues#J Proteome Res 2007 May;6(5):1782-91
NP00335	ERPYSFGL	8	Cancer borealis	Allatostatin	Allatostatin A	18700782#Behrens HL, Chen R, Li L#Combining microdialysis, NanoLC-MS, and MALDI-TOF/TOF to detect neuropeptides secreted in the crab, Cancer borealis#Anal Chem 2008 Sep 15;80(18):6949-58
NP00336	ERPYSGL	7	Cancer borealis	Allatostatin	Allatostatin A	19185513#Chen R, Ma M, Hui L, Zhang J, Li L#Measurement of neuropeptides in crustacean hemolymph via MALDI mass spectrometry#J Am Soc Mass Spectrom 2009 Apr;20(4):708-18
NP00337	PDMYAFGL	8	Cancer borealis	Allatostatin	Allatostatin A	18700782#Behrens HL, Chen R, Li L#Combining microdialysis, NanoLC-MS, and MALDI-TOF/TOF to detect neuropeptides secreted in the crab, Cancer borealis#Anal Chem 2008 Sep 15;80(18):6949-58
NP00338	PRDYAFGL	8	Cancer borealis	Allatostatin	Allatostatin A	17381149#DeKeyser SS, Kutz-Naber KK, Schmidt JJ, Barrett-Wilt GA, Li L#Imaging mass spectrometry of neuropeptides in decapod crustacean neuronal tissues#J Proteome Res 2007 May;6(5):1782-91
NP00339	SPYAFGL	7	Cancer borealis	Allatostatin	Allatostatin A	18700782#Behrens HL, Chen R, Li L#Combining microdialysis, NanoLC-MS, and MALDI-TOF/TOF to detect neuropeptides secreted in the crab, Cancer borealis#Anal Chem 2008 Sep 15;80(18):6949-58
NP00340	YAFGL	5	Cancer borealis	Allatostatin	Allatostatin A	18700782#Behrens HL, Chen R, Li L#Combining microdialysis, NanoLC-MS, and MALDI-TOF/TOF to detect neuropeptides secreted in the crab, Cancer borealis#Anal Chem 2008 Sep 15;80(18):6949-58
NP00341	YSFGL	5	Cancer borealis	Allatostatin	Allatostatin A	18700782#Behrens HL, Chen R, Li L#Combining microdialysis, NanoLC-MS, and MALDI-TOF/TOF to detect neuropeptides secreted in the crab, Cancer borealis#Anal Chem 2008 Sep 15;80(18):6949-58
NP00342	GNWNKFQGSW	10	Cancer borealis	Allatostatin	Allatostatin B	17381149#DeKeyser SS, Kutz-Naber KK, Schmidt JJ, Barrett-Wilt GA, Li L#Imaging mass spectrometry of neuropeptides in decapod crustacean neuronal tissues#J Proteome Res 2007 May;6(5):1782-91
NP00343	NNNWSKFQGSW	11	Cancer borealis	Allatostatin	Allatostatin B	18700782#Behrens HL, Chen R, Li L#Combining microdialysis, NanoLC-MS, and MALDI-TOF/TOF to detect neuropeptides secreted in the crab, Cancer borealis#Anal Chem 2008 Sep 15;80(18):6949-58
NP00344	NNWSKFQGSW	10	Cancer borealis	Allatostatin	Allatostatin B	17381149#DeKeyser SS, Kutz-Naber KK, Schmidt JJ, Barrett-Wilt GA, Li L#Imaging mass spectrometry of neuropeptides in decapod crustacean neuronal tissues#J Proteome Res 2007 May;6(5):1782-91
NP00345	NWNKFQGSW	9	Cancer borealis	Allatostatin	Allatostatin B	18700782#Behrens HL, Chen R, Li L#Combining microdialysis, NanoLC-MS, and MALDI-TOF/TOF to detect neuropeptides secreted in the crab, Cancer borealis#Anal Chem 2008 Sep 15;80(18):6949-58
NP00346	STNWSSLRSAW	11	Cancer borealis	Allatostatin	Allatostatin B	17381149#DeKeyser SS, Kutz-Naber KK, Schmidt JJ, Barrett-Wilt GA, Li L#Imaging mass spectrometry of neuropeptides in decapod crustacean neuronal tissues#J Proteome Res 2007 May;6(5):1782-91
NP00347	TSWFKFQGSW	10	Cancer borealis	Allatostatin	Allatostatin B	18700782#Behrens HL, Chen R, Li L#Combining microdialysis, NanoLC-MS, and MALDI-TOF/TOF to detect neuropeptides secreted in the crab, Cancer borealis#Anal Chem 2008 Sep 15;80(18):6949-58
NP00348	VPNDWAHFRGSW	12	Cancer borealis	Allatostatin	Allatostatin B	17381149#DeKeyser SS, Kutz-Naber KK, Schmidt JJ, Barrett-Wilt GA, Li L#Imaging mass spectrometry of neuropeptides in decapod crustacean neuronal tissues#J Proteome Res 2007 May;6(5):1782-91
NP00349	GGSLYSFGL	9	Cancer borealis	Allatostatin	Allatostatin-3	14535947#Li L, Kelley WP, Billimoria CP, Christie AE, Pulver SR, Sweedler JV, Marder E#Mass spectrometric investigation of the neuropeptide complement and release in the pericardial organs of the crab, Cancer borealis#J Neurochem 2003 Nov;87(3):642-56
NP00350	AWQDLQGGW	9	Carausius morosus	Allatostatin	Cam-AST-B1	16061202#Husson SJ, Clynen E, Baggerman G, De Loof A, Schoofs L#Discovering neuropeptides in Caenorhabditis elegans by two dimensional liquid chromatography and mass spectrometry#Biochem Biophys Res Commun 2005 Sep 16;335(1):76-86
NP00351	AWQDLNTGW	9	Carausius morosus	Allatostatin	Cam-AST-B2	16061202#Husson SJ, Clynen E, Baggerman G, De Loof A, Schoofs L#Discovering neuropeptides in Caenorhabditis elegans by two dimensional liquid chromatography and mass spectrometry#Biochem Biophys Res Commun 2005 Sep 16;335(1):76-86
NP00352	GWQDLQSGW	9	Carausius morosus	Allatostatin	Cam-AST-B3	16061202#Husson SJ, Clynen E, Baggerman G, De Loof A, Schoofs L#Discovering neuropeptides in Caenorhabditis elegans by two dimensional liquid chromatography and mass spectrometry#Biochem Biophys Res Commun 2005 Sep 16;335(1):76-86
NP00353	AWQDLQGAW	9	Carausius morosus	Allatostatin	Cam-AST-B4	16061202#Husson SJ, Clynen E, Baggerman G, De Loof A, Schoofs L#Discovering neuropeptides in Caenorhabditis elegans by two dimensional liquid chromatography and mass spectrometry#Biochem Biophys Res Commun 2005 Sep 16;335(1):76-86
NP00354	AWQDLQAGW	9	Carausius morosus	Allatostatin	Cam-AST-B5	16061202#Husson SJ, Clynen E, Baggerman G, De Loof A, Schoofs L#Discovering neuropeptides in Caenorhabditis elegans by two dimensional liquid chromatography and mass spectrometry#Biochem Biophys Res Commun 2005 Sep 16;335(1):76-86
NP00355	AWQDLGSAW	9	Carausius morosus	Allatostatin	Cam-AST-B6	16061202#Husson SJ, Clynen E, Baggerman G, De Loof A, Schoofs L#Discovering neuropeptides in Caenorhabditis elegans by two dimensional liquid chromatography and mass spectrometry#Biochem Biophys Res Commun 2005 Sep 16;335(1):76-86
NP00356	AAPYAFGL	8	Carcinus maenas	Allatostatin	Allatostatin A	19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34
NP00357	AASPYSFGL	9	Carcinus maenas	Allatostatin	Allatostatin A	19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34
NP00358	APGPYAFGL	9	Carcinus maenas	Allatostatin	Allatostatin A	19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34
NP00359	ARPYAFGL	8	Carcinus maenas	Allatostatin	Allatostatin A	19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34
NP00360	ARPYSFGL	8	Carcinus maenas	Allatostatin	Allatostatin A	19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34
NP00361	EPYEFGL	7	Carcinus maenas	Allatostatin	Allatostatin A	19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34
NP00362	FSGASPYGL	9	Carcinus maenas	Allatostatin	Allatostatin A	19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34
NP00363	GKPYAFGL	8	Carcinus maenas	Allatostatin	Allatostatin A	19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34
NP00364	KLPYSFGL	8	Carcinus maenas	Allatostatin	Allatostatin A	19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34
NP00365	LKAYDFGL	8	Carcinus maenas	Allatostatin	Allatostatin A	19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34
NP00366	PADLYEFGL	9	Carcinus maenas	Allatostatin	Allatostatin A	19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34
NP00367	RGPYAFGL	8	Carcinus maenas	Allatostatin	Allatostatin A	19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34
NP00368	TRPYSFGL	8	Carcinus maenas	Allatostatin	Allatostatin A	19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34
NP00369	AGWNKFQGSW	10	Carcinus maenas	Allatostatin	Allatostatin B	19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34
NP00370	AWSNLGQAW	9	Carcinus maenas	Allatostatin	Allatostatin B	19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34
NP00371	GSNWSNLRGAW	11	Carcinus maenas	Allatostatin	Allatostatin B	19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34
NP00372	GVNWSNLRGAW	11	Carcinus maenas	Allatostatin	Allatostatin B	19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34
NP00373	NNNWSKFQGSW	11	Carcinus maenas	Allatostatin	Allatostatin B	19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34
NP00374	NNWSKFQGSW	10	Carcinus maenas	Allatostatin	Allatostatin B	19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34
NP00375	QWSSMRGAW	9	Carcinus maenas	Allatostatin	Allatostatin B	19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34
NP00376	SGKWSNLRGAW	11	Carcinus maenas	Allatostatin	Allatostatin B	19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34
NP00377	STNWSSLRSAW	11	Carcinus maenas	Allatostatin	Allatostatin B	19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34
NP00378	TSWGKFQGSW	10	Carcinus maenas	Allatostatin	Allatostatin B	19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34
NP00379	VPNDWAHFRGSW	12	Carcinus maenas	Allatostatin	Allatostatin B	19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34
NP00380	VTWGKFQGSW	10	Carcinus maenas	Allatostatin	Allatostatin B	19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34
NP00381	GGPYSXGL	8	Carcinus maenas	Allatostatin	Carcinustatin-16	9461295#Duve H, Johnsen AH, Maestro JL, Scott AG, Jaros PP, Thorpe A#Isolation and identification of multiple neuropeptides of the allatostatin superfamily in the shore crab Carcinus maenas#Eur J Biochem 1997 Dec 15;250(3):727-34
NP00382	SFGGNPTGDPNLNIYSFGL	19	Daphnia pulex	Allatostatin	Allatostatin A1	21830762#Dircksen H, Neupert S, Predel R, Verleyen P, Huybrechts J, Strauss J, Hauser F, Stafflinger E, Schneider M, Pauwels K, Schoofs L, Grimmelikhuijzen CJ#Genomics, transcriptomics, and peptidomics of Daphnia pulex neuropeptides and protein hormones#J Proteome Res 2011 Oct 7;10(10):4478-504
NP00383	TSRSYSINPYSFGL	14	Daphnia pulex	Allatostatin	Allatostatin A2	21830762#Dircksen H, Neupert S, Predel R, Verleyen P, Huybrechts J, Strauss J, Hauser F, Stafflinger E, Schneider M, Pauwels K, Schoofs L, Grimmelikhuijzen CJ#Genomics, transcriptomics, and peptidomics of Daphnia pulex neuropeptides and protein hormones#J Proteome Res 2011 Oct 7;10(10):4478-504
NP00384	GGNAKSYPQQIPYSFGL	17	Daphnia pulex	Allatostatin	Allatostatin A3	21830762#Dircksen H, Neupert S, Predel R, Verleyen P, Huybrechts J, Strauss J, Hauser F, Stafflinger E, Schneider M, Pauwels K, Schoofs L, Grimmelikhuijzen CJ#Genomics, transcriptomics, and peptidomics of Daphnia pulex neuropeptides and protein hormones#J Proteome Res 2011 Oct 7;10(10):4478-504
NP00385	NPTKYNFGL	9	Daphnia pulex	Allatostatin	Allatostatin A4	21830762#Dircksen H, Neupert S, Predel R, Verleyen P, Huybrechts J, Strauss J, Hauser F, Stafflinger E, Schneider M, Pauwels K, Schoofs L, Grimmelikhuijzen CJ#Genomics, transcriptomics, and peptidomics of Daphnia pulex neuropeptides and protein hormones#J Proteome Res 2011 Oct 7;10(10):4478-504
NP00386	PDRFGFGL	8	Daphnia pulex	Allatostatin	Allatostatin A5	21830762#Dircksen H, Neupert S, Predel R, Verleyen P, Huybrechts J, Strauss J, Hauser F, Stafflinger E, Schneider M, Pauwels K, Schoofs L, Grimmelikhuijzen CJ#Genomics, transcriptomics, and peptidomics of Daphnia pulex neuropeptides and protein hormones#J Proteome Res 2011 Oct 7;10(10):4478-504
NP00387	LPVYNFGL	8	Daphnia pulex	Allatostatin	Allatostatin A6	21830762#Dircksen H, Neupert S, Predel R, Verleyen P, Huybrechts J, Strauss J, Hauser F, Stafflinger E, Schneider M, Pauwels K, Schoofs L, Grimmelikhuijzen CJ#Genomics, transcriptomics, and peptidomics of Daphnia pulex neuropeptides and protein hormones#J Proteome Res 2011 Oct 7;10(10):4478-504
NP00388	NNWNRMQGMW	10	Daphnia pulex	Allatostatin	Allatostatin B1	21830762#Dircksen H, Neupert S, Predel R, Verleyen P, Huybrechts J, Strauss J, Hauser F, Stafflinger E, Schneider M, Pauwels K, Schoofs L, Grimmelikhuijzen CJ#Genomics, transcriptomics, and peptidomics of Daphnia pulex neuropeptides and protein hormones#J Proteome Res 2011 Oct 7;10(10):4478-504
NP00389	AWSDLSQQGW	10	Daphnia pulex	Allatostatin	Allatostatin B2	21830762#Dircksen H, Neupert S, Predel R, Verleyen P, Huybrechts J, Strauss J, Hauser F, Stafflinger E, Schneider M, Pauwels K, Schoofs L, Grimmelikhuijzen CJ#Genomics, transcriptomics, and peptidomics of Daphnia pulex neuropeptides and protein hormones#J Proteome Res 2011 Oct 7;10(10):4478-504
NP00390	SWTQLHGVW	9	Daphnia pulex	Allatostatin	Allatostatin B3	21830762#Dircksen H, Neupert S, Predel R, Verleyen P, Huybrechts J, Strauss J, Hauser F, Stafflinger E, Schneider M, Pauwels K, Schoofs L, Grimmelikhuijzen CJ#Genomics, transcriptomics, and peptidomics of Daphnia pulex neuropeptides and protein hormones#J Proteome Res 2011 Oct 7;10(10):4478-504
NP00391	RWDQLHGAW	9	Daphnia pulex	Allatostatin	Allatostatin B4	21830762#Dircksen H, Neupert S, Predel R, Verleyen P, Huybrechts J, Strauss J, Hauser F, Stafflinger E, Schneider M, Pauwels K, Schoofs L, Grimmelikhuijzen CJ#Genomics, transcriptomics, and peptidomics of Daphnia pulex neuropeptides and protein hormones#J Proteome Res 2011 Oct 7;10(10):4478-504
NP00392	SGWNKMQGVW	10	Daphnia pulex	Allatostatin	Allatostatin B5	21830762#Dircksen H, Neupert S, Predel R, Verleyen P, Huybrechts J, Strauss J, Hauser F, Stafflinger E, Schneider M, Pauwels K, Schoofs L, Grimmelikhuijzen CJ#Genomics, transcriptomics, and peptidomics of Daphnia pulex neuropeptides and protein hormones#J Proteome Res 2011 Oct 7;10(10):4478-504
NP00393	GWNQLQGVW	9	Daphnia pulex	Allatostatin	Allatostatin B6	21830762#Dircksen H, Neupert S, Predel R, Verleyen P, Huybrechts J, Strauss J, Hauser F, Stafflinger E, Schneider M, Pauwels K, Schoofs L, Grimmelikhuijzen CJ#Genomics, transcriptomics, and peptidomics of Daphnia pulex neuropeptides and protein hormones#J Proteome Res 2011 Oct 7;10(10):4478-504
NP00394	NWNNLRGAW	9	Daphnia pulex	Allatostatin	Allatostatin B7	21830762#Dircksen H, Neupert S, Predel R, Verleyen P, Huybrechts J, Strauss J, Hauser F, Stafflinger E, Schneider M, Pauwels K, Schoofs L, Grimmelikhuijzen CJ#Genomics, transcriptomics, and peptidomics of Daphnia pulex neuropeptides and protein hormones#J Proteome Res 2011 Oct 7;10(10):4478-504
NP00395	ESGWNNLKGLW	11	Daphnia pulex	Allatostatin	Allatostatin B8	21830762#Dircksen H, Neupert S, Predel R, Verleyen P, Huybrechts J, Strauss J, Hauser F, Stafflinger E, Schneider M, Pauwels K, Schoofs L, Grimmelikhuijzen CJ#Genomics, transcriptomics, and peptidomics of Daphnia pulex neuropeptides and protein hormones#J Proteome Res 2011 Oct 7;10(10):4478-504
NP00396	SYWKQCAFNAVSCF	14	Daphnia pulex	Allatostatin	Allatostatin C1	21830762#Dircksen H, Neupert S, Predel R, Verleyen P, Huybrechts J, Strauss J, Hauser F, Stafflinger E, Schneider M, Pauwels K, Schoofs L, Grimmelikhuijzen CJ#Genomics, transcriptomics, and peptidomics of Daphnia pulex neuropeptides and protein hormones#J Proteome Res 2011 Oct 7;10(10):4478-504
NP00397	GQSSQRVFWRCYFNAVSCF	19	Daphnia pulex	Allatostatin	Allatostatin C2	21830762#Dircksen H, Neupert S, Predel R, Verleyen P, Huybrechts J, Strauss J, Hauser F, Stafflinger E, Schneider M, Pauwels K, Schoofs L, Grimmelikhuijzen CJ#Genomics, transcriptomics, and peptidomics of Daphnia pulex neuropeptides and protein hormones#J Proteome Res 2011 Oct 7;10(10):4478-504
NP00398	SKQLRYHHCYFNPISCF	17	Daphnia pulex	Allatostatin	Allatostatin C3	21830762#Dircksen H, Neupert S, Predel R, Verleyen P, Huybrechts J, Strauss J, Hauser F, Stafflinger E, Schneider M, Pauwels K, Schoofs L, Grimmelikhuijzen CJ#Genomics, transcriptomics, and peptidomics of Daphnia pulex neuropeptides and protein hormones#J Proteome Res 2011 Oct 7;10(10):4478-504
NP00399	AYSYVSEYKRLPVYSFGL	18	Diploptera punctata	Allatostatin	Allatostatin B	10545101#Birgül N, Weise C, Kreienkamp HJ, Richter D#Reverse physiology in drosophila: identification of a novel allatostatin-like neuropeptide and its cognate receptor structurally related to the mammalian somatostatin/galanin/opioid receptor family#EMBO J 1999 Nov 1;18(21):5892-900
NP00400	EAQGWNKFRGAW	12	Drosophila melanogaster	Allatostatin	MIP3	16061202#Husson SJ, Clynen E, Baggerman G, De Loof A, Schoofs L#Discovering neuropeptides in Caenorhabditis elegans by two dimensional liquid chromatography and mass spectrometry#Biochem Biophys Res Commun 2005 Sep 16;335(1):76-86
NP00401	SRPYLFGL	8	Galleria mellonella	Allatostatin	Bom-AST-3	15706623#Huybrechts J, Verleyen P, Schoofs L#Mass spectrometric analysis of head ganglia and neuroendocrine tissue of larval Galleria mellonella (Arthropoda, Insecta)#J Mass Spectrom 2005 Feb;40(2):271-6
NP00402	ARPYSFGL	8	Galleria mellonella	Allatostatin	Bom-AST-4	15706623#Huybrechts J, Verleyen P, Schoofs L#Mass spectrometric analysis of head ganglia and neuroendocrine tissue of larval Galleria mellonella (Arthropoda, Insecta)#J Mass Spectrom 2005 Feb;40(2):271-6
NP00403	LSSKFNFGL	9	Galleria mellonella	Allatostatin	Bom-AST-7	15706623#Huybrechts J, Verleyen P, Schoofs L#Mass spectrometric analysis of head ganglia and neuroendocrine tissue of larval Galleria mellonella (Arthropoda, Insecta)#J Mass Spectrom 2005 Feb;40(2):271-6
NP00404	SRPYSFGL	8	Galleria mellonella	Allatostatin	Hea-AST-7	15706623#Huybrechts J, Verleyen P, Schoofs L#Mass spectrometric analysis of head ganglia and neuroendocrine tissue of larval Galleria mellonella (Arthropoda, Insecta)#J Mass Spectrom 2005 Feb;40(2):271-6
NP00405	SPHYDFGL	8	Galleria mellonella	Allatostatin	Helicostatin-1	15706623#Huybrechts J, Verleyen P, Schoofs L#Mass spectrometric analysis of head ganglia and neuroendocrine tissue of larval Galleria mellonella (Arthropoda, Insecta)#J Mass Spectrom 2005 Feb;40(2):271-6
NP00406	GWQDLNGGW	9	Gryllus bimaculatus	Allatostatin	Grb-AST-B1	16061202#Husson SJ, Clynen E, Baggerman G, De Loof A, Schoofs L#Discovering neuropeptides in Caenorhabditis elegans by two dimensional liquid chromatography and mass spectrometry#Biochem Biophys Res Commun 2005 Sep 16;335(1):76-86
NP00407	GWRDLNGGW	9	Gryllus bimaculatus	Allatostatin	Grb-AST-B2	16061202#Husson SJ, Clynen E, Baggerman G, De Loof A, Schoofs L#Discovering neuropeptides in Caenorhabditis elegans by two dimensional liquid chromatography and mass spectrometry#Biochem Biophys Res Commun 2005 Sep 16;335(1):76-86
NP00408	AWRDLSGGW	9	Gryllus bimaculatus	Allatostatin	Grb-AST-B3	16061202#Husson SJ, Clynen E, Baggerman G, De Loof A, Schoofs L#Discovering neuropeptides in Caenorhabditis elegans by two dimensional liquid chromatography and mass spectrometry#Biochem Biophys Res Commun 2005 Sep 16;335(1):76-86
NP00409	AWERFHGSW	9	Gryllus bimaculatus	Allatostatin	Grb-AST-B4	16061202#Husson SJ, Clynen E, Baggerman G, De Loof A, Schoofs L#Discovering neuropeptides in Caenorhabditis elegans by two dimensional liquid chromatography and mass spectrometry#Biochem Biophys Res Commun 2005 Sep 16;335(1):76-86
NP00410	AWQDLNAGW	9	Gryllus bimaculatus	Allatostatin	Locustamyoinhibiting peptide	7673141#Lorenz MW, Kellner R, Hoffmann KH#A family of neuropeptides that inhibit juvenile hormone biosynthesis in the cricket, Gryllus bimaculatus#J Biol Chem 1995 Sep 8;270(36):21103-8
NP00411	AGGAYSFGL	9	Homarus americanus	Allatostatin	Allatostatin A	18304551#Ma M, Chen R, Sousa GL, Bors EK, Kwiatkowski MA, Goiney CC, Goy MF, Christie AE, Li L#Mass spectral characterization of peptide transmitters/hormones in the nervous system and neuroendocrine organs of the American lobster Homarus americanus#Gen Comp Endocrinol 2008 Apr 1;156(2):395-409
NP00412	AGPYAFGL	8	Homarus americanus	Allatostatin	Allatostatin A	18304551#Ma M, Chen R, Sousa GL, Bors EK, Kwiatkowski MA, Goiney CC, Goy MF, Christie AE, Li L#Mass spectral characterization of peptide transmitters/hormones in the nervous system and neuroendocrine organs of the American lobster Homarus americanus#Gen Comp Endocrinol 2008 Apr 1;156(2):395-409
NP00413	AGPYSFGL	8	Homarus americanus	Allatostatin	Allatostatin A	18088365#Cape SS, Rehm KJ, Ma M, Marder E, Li L#Mass spectral comparison of the neuropeptide complement of the stomatogastric ganglion and brain in the adult and embryonic lobster, Homarus americanus#J Neurochem 2008 May;105(3):690-702
NP00414	ASPYAFGL	8	Homarus americanus	Allatostatin	Allatostatin A	20025296#Chen R, Jiang X, Conaway MC, Mohtashemi I, Hui L, Viner R, Li L#Mass spectral analysis of neuropeptide expression and distribution in the nervous system of the lobster Homarus americanus#J Proteome Res 2010 Feb 5;9(2):818-32
NP00415	EPYAFGL	7	Homarus americanus	Allatostatin	Allatostatin A	18304551#Ma M, Chen R, Sousa GL, Bors EK, Kwiatkowski MA, Goiney CC, Goy MF, Christie AE, Li L#Mass spectral characterization of peptide transmitters/hormones in the nervous system and neuroendocrine organs of the American lobster Homarus americanus#Gen Comp Endocrinol 2008 Apr 1;156(2):395-409
NP00416	ERAYSFGL	8	Homarus americanus	Allatostatin	Allatostatin A	20025296#Chen R, Jiang X, Conaway MC, Mohtashemi I, Hui L, Viner R, Li L#Mass spectral analysis of neuropeptide expression and distribution in the nervous system of the lobster Homarus americanus#J Proteome Res 2010 Feb 5;9(2):818-32
NP00417	PRDYAFGL	8	Homarus americanus	Allatostatin	Allatostatin A	22860213#Jiang X, Chen R, Wang J, Metzler A, Tlusty M, Li L#Mass spectral charting of neuropeptidomic expression in the stomatogastric ganglion at multiple developmental stages of the lobster Homarus americanus#ACS Chem Neurosci 2012 Jun 20;3(6):439-50
NP00418	PRNYAFGL	8	Homarus americanus	Allatostatin	Allatostatin A	22860213#Jiang X, Chen R, Wang J, Metzler A, Tlusty M, Li L#Mass spectral charting of neuropeptidomic expression in the stomatogastric ganglion at multiple developmental stages of the lobster Homarus americanus#ACS Chem Neurosci 2012 Jun 20;3(6):439-50
NP00419	RQYAFGL	7	Homarus americanus	Allatostatin	Allatostatin A	22860213#Jiang X, Chen R, Wang J, Metzler A, Tlusty M, Li L#Mass spectral charting of neuropeptidomic expression in the stomatogastric ganglion at multiple developmental stages of the lobster Homarus americanus#ACS Chem Neurosci 2012 Jun 20;3(6):439-50
NP00420	SGPYAFGL	8	Homarus americanus	Allatostatin	Allatostatin A	18304551#Ma M, Chen R, Sousa GL, Bors EK, Kwiatkowski MA, Goiney CC, Goy MF, Christie AE, Li L#Mass spectral characterization of peptide transmitters/hormones in the nervous system and neuroendocrine organs of the American lobster Homarus americanus#Gen Comp Endocrinol 2008 Apr 1;156(2):395-409
NP00421	SGPYSFGL	8	Homarus americanus	Allatostatin	Allatostatin A	18304551#Ma M, Chen R, Sousa GL, Bors EK, Kwiatkowski MA, Goiney CC, Goy MF, Christie AE, Li L#Mass spectral characterization of peptide transmitters/hormones in the nervous system and neuroendocrine organs of the American lobster Homarus americanus#Gen Comp Endocrinol 2008 Apr 1;156(2):395-409
NP00422	SPYAFGL	7	Homarus americanus	Allatostatin	Allatostatin A	18304551#Ma M, Chen R, Sousa GL, Bors EK, Kwiatkowski MA, Goiney CC, Goy MF, Christie AE, Li L#Mass spectral characterization of peptide transmitters/hormones in the nervous system and neuroendocrine organs of the American lobster Homarus americanus#Gen Comp Endocrinol 2008 Apr 1;156(2):395-409
NP00423	SQYTFGL	7	Homarus americanus	Allatostatin	Allatostatin A	18304551#Ma M, Chen R, Sousa GL, Bors EK, Kwiatkowski MA, Goiney CC, Goy MF, Christie AE, Li L#Mass spectral characterization of peptide transmitters/hormones in the nervous system and neuroendocrine organs of the American lobster Homarus americanus#Gen Comp Endocrinol 2008 Apr 1;156(2):395-409
NP00424	TPSYAFGL	8	Homarus americanus	Allatostatin	Allatostatin A	18304551#Ma M, Chen R, Sousa GL, Bors EK, Kwiatkowski MA, Goiney CC, Goy MF, Christie AE, Li L#Mass spectral characterization of peptide transmitters/hormones in the nervous system and neuroendocrine organs of the American lobster Homarus americanus#Gen Comp Endocrinol 2008 Apr 1;156(2):395-409
NP00425	VGPYAFGL	8	Homarus americanus	Allatostatin	Allatostatin A	18304551#Ma M, Chen R, Sousa GL, Bors EK, Kwiatkowski MA, Goiney CC, Goy MF, Christie AE, Li L#Mass spectral characterization of peptide transmitters/hormones in the nervous system and neuroendocrine organs of the American lobster Homarus americanus#Gen Comp Endocrinol 2008 Apr 1;156(2):395-409
NP00426	VPRYAFG	7	Homarus americanus	Allatostatin	Allatostatin A	20025296#Chen R, Jiang X, Conaway MC, Mohtashemi I, Hui L, Viner R, Li L#Mass spectral analysis of neuropeptide expression and distribution in the nervous system of the lobster Homarus americanus#J Proteome Res 2010 Feb 5;9(2):818-32
NP00427	GNWNKFQGSW	10	Homarus americanus	Allatostatin	Allatostatin B	18304551#Ma M, Chen R, Sousa GL, Bors EK, Kwiatkowski MA, Goiney CC, Goy MF, Christie AE, Li L#Mass spectral characterization of peptide transmitters/hormones in the nervous system and neuroendocrine organs of the American lobster Homarus americanus#Gen Comp Endocrinol 2008 Apr 1;156(2):395-409
NP00428	NWNKFQGSW	9	Homarus americanus	Allatostatin	Allatostatin B	18304551#Ma M, Chen R, Sousa GL, Bors EK, Kwiatkowski MA, Goiney CC, Goy MF, Christie AE, Li L#Mass spectral characterization of peptide transmitters/hormones in the nervous system and neuroendocrine organs of the American lobster Homarus americanus#Gen Comp Endocrinol 2008 Apr 1;156(2):395-409
NP00429	STNWSSLRSAW	11	Homarus americanus	Allatostatin	Allatostatin B	22860213#Jiang X, Chen R, Wang J, Metzler A, Tlusty M, Li L#Mass spectral charting of neuropeptidomic expression in the stomatogastric ganglion at multiple developmental stages of the lobster Homarus americanus#ACS Chem Neurosci 2012 Jun 20;3(6):439-50
NP00430	TNWNKFQGSW	10	Homarus americanus	Allatostatin	Allatostatin B	22860213#Jiang X, Chen R, Wang J, Metzler A, Tlusty M, Li L#Mass spectral charting of neuropeptidomic expression in the stomatogastric ganglion at multiple developmental stages of the lobster Homarus americanus#ACS Chem Neurosci 2012 Jun 20;3(6):439-50
NP00431	QIRYHQCYFNPISCF	15	Homarus americanus	Allatostatin	Allatostatin C	20025296#Chen R, Jiang X, Conaway MC, Mohtashemi I, Hui L, Viner R, Li L#Mass spectral analysis of neuropeptide expression and distribution in the nervous system of the lobster Homarus americanus#J Proteome Res 2010 Feb 5;9(2):818-32
NP00432	SGWKQCSFNAVSCF	14	Ixodes scapularis	Allatostatin	Allatostatin-C	19540946#Neupert S, Russell WK, Predel R, Russell DH, Strey OF, Teel PD, Nachman RJ#The neuropeptidomics of Ixodes scapularis synganglion#J Proteomics 2009 Aug 20;72(6):1040-5
NP00433	ASDWNRLSGMW	11	Ixodes scapularis	Allatostatin	Myoinhibitory peptide	19540946#Neupert S, Russell WK, Predel R, Russell DH, Strey OF, Teel PD, Nachman RJ#The neuropeptidomics of Ixodes scapularis synganglion#J Proteomics 2009 Aug 20;72(6):1040-5
NP00434	ANQYAFGL	8	Litopenaeus vannamei	Allatostatin	Allatostatin A	19852991#Ma M, Gard AL, Xiang F, Wang J, Davoodian N, Lenz PH, Malecha SR, Christie AE, Li L#Combining in silico transcriptome mining and biological mass spectrometry for neuropeptide discovery in the Pacific white shrimp Litopenaeus vannamei#Peptides 2010 Jan;31(1):27-43
NP00435	DRLYAFGL	8	Litopenaeus vannamei	Allatostatin	Allatostatin A	19852991#Ma M, Gard AL, Xiang F, Wang J, Davoodian N, Lenz PH, Malecha SR, Christie AE, Li L#Combining in silico transcriptome mining and biological mass spectrometry for neuropeptide discovery in the Pacific white shrimp Litopenaeus vannamei#Peptides 2010 Jan;31(1):27-43
NP00436	HGSYAFGL	8	Litopenaeus vannamei	Allatostatin	Allatostatin A	19852991#Ma M, Gard AL, Xiang F, Wang J, Davoodian N, Lenz PH, Malecha SR, Christie AE, Li L#Combining in silico transcriptome mining and biological mass spectrometry for neuropeptide discovery in the Pacific white shrimp Litopenaeus vannamei#Peptides 2010 Jan;31(1):27-43
NP00437	SSKPYAFGL	9	Litopenaeus vannamei	Allatostatin	Allatostatin A	19852991#Ma M, Gard AL, Xiang F, Wang J, Davoodian N, Lenz PH, Malecha SR, Christie AE, Li L#Combining in silico transcriptome mining and biological mass spectrometry for neuropeptide discovery in the Pacific white shrimp Litopenaeus vannamei#Peptides 2010 Jan;31(1):27-43
NP00438	ADWNKFQGSW	10	Litopenaeus vannamei	Allatostatin	Allatostatin B	19852991#Ma M, Gard AL, Xiang F, Wang J, Davoodian N, Lenz PH, Malecha SR, Christie AE, Li L#Combining in silico transcriptome mining and biological mass spectrometry for neuropeptide discovery in the Pacific white shrimp Litopenaeus vannamei#Peptides 2010 Jan;31(1):27-43
NP00439	KWAAGRSAW	9	Litopenaeus vannamei	Allatostatin	Allatostatin B	19852991#Ma M, Gard AL, Xiang F, Wang J, Davoodian N, Lenz PH, Malecha SR, Christie AE, Li L#Combining in silico transcriptome mining and biological mass spectrometry for neuropeptide discovery in the Pacific white shrimp Litopenaeus vannamei#Peptides 2010 Jan;31(1):27-43
NP00440	LTWNKFQGSW	10	Litopenaeus vannamei	Allatostatin	Allatostatin B	19852991#Ma M, Gard AL, Xiang F, Wang J, Davoodian N, Lenz PH, Malecha SR, Christie AE, Li L#Combining in silico transcriptome mining and biological mass spectrometry for neuropeptide discovery in the Pacific white shrimp Litopenaeus vannamei#Peptides 2010 Jan;31(1):27-43
NP00441	NWNKFQGSW	9	Litopenaeus vannamei	Allatostatin	Allatostatin B	19852991#Ma M, Gard AL, Xiang F, Wang J, Davoodian N, Lenz PH, Malecha SR, Christie AE, Li L#Combining in silico transcriptome mining and biological mass spectrometry for neuropeptide discovery in the Pacific white shrimp Litopenaeus vannamei#Peptides 2010 Jan;31(1):27-43
NP00442	RWSKFQGSW	9	Litopenaeus vannamei	Allatostatin	Allatostatin B	19852991#Ma M, Gard AL, Xiang F, Wang J, Davoodian N, Lenz PH, Malecha SR, Christie AE, Li L#Combining in silico transcriptome mining and biological mass spectrometry for neuropeptide discovery in the Pacific white shrimp Litopenaeus vannamei#Peptides 2010 Jan;31(1):27-43
NP00443	SADWNSLRGTW	11	Litopenaeus vannamei	Allatostatin	Allatostatin B	19852991#Ma M, Gard AL, Xiang F, Wang J, Davoodian N, Lenz PH, Malecha SR, Christie AE, Li L#Combining in silico transcriptome mining and biological mass spectrometry for neuropeptide discovery in the Pacific white shrimp Litopenaeus vannamei#Peptides 2010 Jan;31(1):27-43
NP00444	STNWSNLRGTW	11	Litopenaeus vannamei	Allatostatin	Allatostatin B	19852991#Ma M, Gard AL, Xiang F, Wang J, Davoodian N, Lenz PH, Malecha SR, Christie AE, Li L#Combining in silico transcriptome mining and biological mass spectrometry for neuropeptide discovery in the Pacific white shrimp Litopenaeus vannamei#Peptides 2010 Jan;31(1):27-43
NP00445	VPNDWAHFRGSW	12	Litopenaeus vannamei	Allatostatin	Allatostatin B	19852991#Ma M, Gard AL, Xiang F, Wang J, Davoodian N, Lenz PH, Malecha SR, Christie AE, Li L#Combining in silico transcriptome mining and biological mass spectrometry for neuropeptide discovery in the Pacific white shrimp Litopenaeus vannamei#Peptides 2010 Jan;31(1):27-43
NP00446	VERYAFGL	8	Lucilia cuprina	Allatostatin	Allatostatin 1	23280433#Rahman MM, Neupert S, Predel R#Neuropeptidomics of the Australian sheep blowfly Lucilia cuprina (Wiedemann) and related Diptera#Peptides 2013 Mar;41:31-7
NP00447	ARPYSFGL	8	Lucilia cuprina	Allatostatin	Allatostatin 3	23280433#Rahman MM, Neupert S, Predel R#Neuropeptidomics of the Australian sheep blowfly Lucilia cuprina (Wiedemann) and related Diptera#Peptides 2013 Mar;41:31-7
NP00448	NRPYSFGL	8	Lucilia cuprina	Allatostatin	Allatostatin-4	23280433#Rahman MM, Neupert S, Predel R#Neuropeptidomics of the Australian sheep blowfly Lucilia cuprina (Wiedemann) and related Diptera#Peptides 2013 Mar;41:31-7
NP00449	DPLNEERRANRYGFGL	16	Lucilia cuprina	Allatostatin	Allatostatin-5	23280433#Rahman MM, Neupert S, Predel R#Neuropeptidomics of the Australian sheep blowfly Lucilia cuprina (Wiedemann) and related Diptera#Peptides 2013 Mar;41:31-7
NP00450	ANRYGFGL	8	Lucilia cuprina	Allatostatin	Callatostatin-3	23280433#Rahman MM, Neupert S, Predel R#Neuropeptidomics of the Australian sheep blowfly Lucilia cuprina (Wiedemann) and related Diptera#Peptides 2013 Mar;41:31-7
NP00451	EVRFRQCYFNPISCF	15	Manduca sexta	Allatostatin	Allatostatin	14599724#Audsley N, Weaver RJ#A comparison of the neuropeptides from the retrocerebral complex of adult male and female Manduca sexta using MALDI-TOF mass spectrometry#Regul Pept 2003 Nov 15;116(1-3):127-37
NP00452	AYSYVSEYKRLPVYNFGL	18	Manduca sexta	Allatostatin	Cydiastatin 2	14599724#Audsley N, Weaver RJ#A comparison of the neuropeptides from the retrocerebral complex of adult male and female Manduca sexta using MALDI-TOF mass spectrometry#Regul Pept 2003 Nov 15;116(1-3):127-37
NP00453	LPVYNFGL	8	Manduca sexta	Allatostatin	Cydiastatin 2 11–18	14599724#Audsley N, Weaver RJ#A comparison of the neuropeptides from the retrocerebral complex of adult male and female Manduca sexta using MALDI-TOF mass spectrometry#Regul Pept 2003 Nov 15;116(1-3):127-37
NP00454	SRPYSFGL	8	Manduca sexta	Allatostatin	Cydiastatin 3	14599724#Audsley N, Weaver RJ#A comparison of the neuropeptides from the retrocerebral complex of adult male and female Manduca sexta using MALDI-TOF mass spectrometry#Regul Pept 2003 Nov 15;116(1-3):127-37
NP00455	ARPYSFGL	8	Manduca sexta	Allatostatin	Cydiastatin 4	14599724#Audsley N, Weaver RJ#A comparison of the neuropeptides from the retrocerebral complex of adult male and female Manduca sexta using MALDI-TOF mass spectrometry#Regul Pept 2003 Nov 15;116(1-3):127-37
NP00456	SPHYDFGL	8	Manduca sexta	Allatostatin	Helicostatin-1	14599724#Audsley N, Weaver RJ#A comparison of the neuropeptides from the retrocerebral complex of adult male and female Manduca sexta using MALDI-TOF mass spectrometry#Regul Pept 2003 Nov 15;116(1-3):127-37
NP00457	ARAYDFGL	8	Manduca sexta	Allatostatin	Helicostatin-5	14706525#Audsley N, Weaver RJ#Identification of neuropeptides from brains of larval Manduca sexta and Lacanobia oleracea using MALDI-TOF mass spectrometry and post-source decay#Peptides 2003 Oct;24(10):1465-74
NP00458	LPMYNFGL	8	Manduca sexta	Allatostatin	Helicostatin-6	14599724#Audsley N, Weaver RJ#A comparison of the neuropeptides from the retrocerebral complex of adult male and female Manduca sexta using MALDI-TOF mass spectrometry#Regul Pept 2003 Nov 15;116(1-3):127-37
NP00459	ARSYNFGL	8	Manduca sexta	Allatostatin	Helicostatin-7	14599724#Audsley N, Weaver RJ#A comparison of the neuropeptides from the retrocerebral complex of adult male and female Manduca sexta using MALDI-TOF mass spectrometry#Regul Pept 2003 Nov 15;116(1-3):127-37
NP00460	ERDMHRFSFGL	11	Manduca sexta	Allatostatin	Helicostatin-9	14706525#Audsley N, Weaver RJ#Identification of neuropeptides from brains of larval Manduca sexta and Lacanobia oleracea using MALDI-TOF mass spectrometry and post-source decay#Peptides 2003 Oct;24(10):1465-74
NP00461	GWQDLNSAW	9	Manduca sexta	Allatostatin	Mas-MIP II	16061202#Husson SJ, Clynen E, Baggerman G, De Loof A, Schoofs L#Discovering neuropeptides in Caenorhabditis elegans by two dimensional liquid chromatography and mass spectrometry#Biochem Biophys Res Commun 2005 Sep 16;335(1):76-86
NP00462	AWQDLNSAW	9	Manduca sexta	Allatostatin	Mas-MIP1	16061202#Husson SJ, Clynen E, Baggerman G, De Loof A, Schoofs L#Discovering neuropeptides in Caenorhabditis elegans by two dimensional liquid chromatography and mass spectrometry#Biochem Biophys Res Commun 2005 Sep 16;335(1):76-86
NP00463	APEKWAAFHGSW	12	Manduca sexta	Allatostatin	MIP III	14599724#Audsley N, Weaver RJ#A comparison of the neuropeptides from the retrocerebral complex of adult male and female Manduca sexta using MALDI-TOF mass spectrometry#Regul Pept 2003 Nov 15;116(1-3):127-37
NP00464	GWQDMSSAW	9	Manduca sexta	Allatostatin	MIP V	14599724#Audsley N, Weaver RJ#A comparison of the neuropeptides from the retrocerebral complex of adult male and female Manduca sexta using MALDI-TOF mass spectrometry#Regul Pept 2003 Nov 15;116(1-3):127-37
NP00465	AWSALHGAW	9	Manduca sexta	Allatostatin	MIP VI	14599724#Audsley N, Weaver RJ#A comparison of the neuropeptides from the retrocerebral complex of adult male and female Manduca sexta using MALDI-TOF mass spectrometry#Regul Pept 2003 Nov 15;116(1-3):127-37
NP00466	LPIYQFGL	8	Nasonia vitripennis	Allatostatin	Allatostatin-A-1	20695486#Hauser F, Neupert S, Williamson M, Predel R, Tanaka Y, Grimmelikhuijzen CJ#Genomics and peptidomics of neuropeptides and protein hormones present in the parasitic wasp Nasonia vitripennis#J Proteome Res 2010 Oct 1;9(10):5296-310
NP00467	SQPFSFGL	8	Nasonia vitripennis	Allatostatin	Allatostatin-A-2	20695486#Hauser F, Neupert S, Williamson M, Predel R, Tanaka Y, Grimmelikhuijzen CJ#Genomics and peptidomics of neuropeptides and protein hormones present in the parasitic wasp Nasonia vitripennis#J Proteome Res 2010 Oct 1;9(10):5296-310
NP00468	TRPYSFGL	8	Nasonia vitripennis	Allatostatin	Allatostatin-A-3	20695486#Hauser F, Neupert S, Williamson M, Predel R, Tanaka Y, Grimmelikhuijzen CJ#Genomics and peptidomics of neuropeptides and protein hormones present in the parasitic wasp Nasonia vitripennis#J Proteome Res 2010 Oct 1;9(10):5296-310
NP00469	DKYLFGL	7	Nasonia vitripennis	Allatostatin	Allatostatin-A-5	20695486#Hauser F, Neupert S, Williamson M, Predel R, Tanaka Y, Grimmelikhuijzen CJ#Genomics and peptidomics of neuropeptides and protein hormones present in the parasitic wasp Nasonia vitripennis#J Proteome Res 2010 Oct 1;9(10):5296-310
NP00470	AGPYAFGL	8	Ocypode ceratophthalma	Allatostatin	Allatostatin A	23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34
NP00471	ARPYSFGL	8	Ocypode ceratophthalma	Allatostatin	Allatostatin A	23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34
NP00472	DGPYSFGL	8	Ocypode ceratophthalma	Allatostatin	Allatostatin A	23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34
NP00473	EAYAGFL	7	Ocypode ceratophthalma	Allatostatin	Allatostatin A	23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34
NP00474	EPQYSFGL	8	Ocypode ceratophthalma	Allatostatin	Allatostatin A	23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34
NP00475	EPYAFGL	7	Ocypode ceratophthalma	Allatostatin	Allatostatin A	23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34
NP00476	FSGASPYGL	9	Ocypode ceratophthalma	Allatostatin	Allatostatin A	23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34
NP00477	KLPTGYQFGL	10	Ocypode ceratophthalma	Allatostatin	Allatostatin A	23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34
NP00478	PRDYAFGL	8	Ocypode ceratophthalma	Allatostatin	Allatostatin A	23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34
NP00479	RGPYAFGL	8	Ocypode ceratophthalma	Allatostatin	Allatostatin A	23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34
NP00480	SDMYSFGL	8	Ocypode ceratophthalma	Allatostatin	Allatostatin A	23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34
NP00481	SGHYIFGL	8	Ocypode ceratophthalma	Allatostatin	Allatostatin A	23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34
NP00482	SNPYSFGL	8	Ocypode ceratophthalma	Allatostatin	Allatostatin A	23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34
NP00483	SRPYSFGL	8	Ocypode ceratophthalma	Allatostatin	Allatostatin A	23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34
NP00484	TRPYSFGL	8	Ocypode ceratophthalma	Allatostatin	Allatostatin A	23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34
NP00485	YDFEASSYSFGL	12	Ocypode ceratophthalma	Allatostatin	Allatostatin A	23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34
NP00486	AWSNLGQAW	9	Ocypode ceratophthalma	Allatostatin	Allatostatin B	23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34
NP00487	DDWSQFQGSW	10	Ocypode ceratophthalma	Allatostatin	Allatostatin B	23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34
NP00488	DGSSNLRGAW	10	Ocypode ceratophthalma	Allatostatin	Allatostatin B	23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34
NP00489	GNWNKFQGSW	10	Ocypode ceratophthalma	Allatostatin	Allatostatin B	23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34
NP00490	NNWSKFQGSW	10	Ocypode ceratophthalma	Allatostatin	Allatostatin B	23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34
NP00491	SDGWSPSGDGSW	12	Ocypode ceratophthalma	Allatostatin	Allatostatin B	23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34
NP00492	SGDWSSLRGAW	11	Ocypode ceratophthalma	Allatostatin	Allatostatin B	23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34
NP00493	SPNDWAHFRGSW	12	Ocypode ceratophthalma	Allatostatin	Allatostatin B	23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34
NP00494	STNWSSCPTSAW	12	Ocypode ceratophthalma	Allatostatin	Allatostatin B	23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34
NP00495	STNWSSLRSAW	11	Ocypode ceratophthalma	Allatostatin	Allatostatin B	23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34
NP00496	TGWSSTSRAW	10	Ocypode ceratophthalma	Allatostatin	Allatostatin B	23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34
NP00497	TGWSVFQGSW	10	Ocypode ceratophthalma	Allatostatin	Allatostatin B	23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34
NP00498	TQWSKFQGSW	10	Ocypode ceratophthalma	Allatostatin	Allatostatin B	23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34
NP00499	TSWGKFQGSW	10	Ocypode ceratophthalma	Allatostatin	Allatostatin B	23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34
NP00500	TSWGKYQGSW	10	Ocypode ceratophthalma	Allatostatin	Allatostatin B	23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34
NP00501	ANEDEDAASLFAFGL	15	Penaeus monodon	Allatostatin	Allatostatin	21459120#Chansela P, Goto-Inoue N, Zaima N, Sroyraya M, Sobhon P, Setou M#Visualization of neuropeptides in paraffin-embedded tissue sections of the central nervous system in the decapod crustacean, Penaeus monodon, by imaging mass spectrometry#Peptides 2012 Mar;34(1):10-8
NP00502	SGHYNFGL	8	Penaeus monodon	Allatostatin	Allatostatin A	21459120#Chansela P, Goto-Inoue N, Zaima N, Sroyraya M, Sobhon P, Setou M#Visualization of neuropeptides in paraffin-embedded tissue sections of the central nervous system in the decapod crustacean, Penaeus monodon, by imaging mass spectrometry#Peptides 2012 Mar;34(1):10-8
NP00503	NWGQFHGGW	9	Zophobas atratus	Allatostatin	Trica-MIP-4	21067424#Marciniak P, Audsley N, Kuczer M, Rosinski G#Identification of myotropic neuropeptides from the brain and corpus cardiacum-corpus allatum complex of the beetle, Zophobas atratus#J Insect Sci 2010;10:156
NP00504	AYTYVSEY	8	Apis mellifera	Allatostatin	Allatostatin-1	17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J., Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L., Robinson G.E., Sweedler J.V.; #From the genome to the proteome: uncovering peptides in the Apis brain.; #Science 314:647-649(2006).
NP00505	LPVYNFGI	8	Apis mellifera	Allatostatin	Allatostatin-2a	17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J., Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L., Robinson G.E., Sweedler J.V.; #From the genome to the proteome: uncovering peptides in the Apis brain.; #Science 314:647-649(2006).
NP00506	LPVYNF	6	Apis mellifera	Allatostatin	Allatostatin-2b	17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J., Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L., Robinson G.E., Sweedler J.V.; #From the genome to the proteome: uncovering peptides in the Apis brain.; #Science 314:647-649(2006).
NP00507	GRDYSFGL	8	Apis mellifera	Allatostatin	Allatostatin-3	17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J., Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L., Robinson G.E., Sweedler J.V.; #From the genome to the proteome: uncovering peptides in the Apis brain.; #Science 314:647-649(2006).
NP00508	RQYSFGL	7	Apis mellifera	Allatostatin	Allatostatin-4	17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J., Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L., Robinson G.E., Sweedler J.V.; #From the genome to the proteome: uncovering peptides in the Apis brain.; #Science 314:647-649(2006).
NP00509	NDNADYPLRLNLDYLPVDNPAFHSQENTDDFLEE	34	Apis mellifera	Allatostatin	Allatostatin-5	17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J., Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L., Robinson G.E., Sweedler J.V.; #From the genome to the proteome: uncovering peptides in the Apis brain.; #Science 314:647-649(2006).
NP00510	GRQPYSFGL	9	Apis mellifera	Allatostatin	Allatostatin-6	17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J., Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L., Robinson G.E., Sweedler J.V.; #From the genome to the proteome: uncovering peptides in the Apis brain.; #Science 314:647-649(2006).
NP00511	AVHYSGGQPLGSKRPNDMLSQRYHFGL	27	Apis mellifera	Allatostatin	Allatostatin-7a	17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J., Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L., Robinson G.E., Sweedler J.V.; #From the genome to the proteome: uncovering peptides in the Apis brain.; #Science 314:647-649(2006).
NP00512	AVHYSGGQPLGS	12	Apis mellifera	Allatostatin	Allatostatin-7b	17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J., Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L., Robinson G.E., Sweedler J.V.; #From the genome to the proteome: uncovering peptides in the Apis brain.; #Science 314:647-649(2006).
NP00513	PNDMLSQRYHFGL	13	Apis mellifera	Allatostatin	Allatostatin-7c	17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J., Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L., Robinson G.E., Sweedler J.V.; #From the genome to the proteome: uncovering peptides in the Apis brain.; #Science 314:647-649(2006).
NP00514	DPLNEERRANRYGFGL	16	Calliphora vomitoria	Allatostatin	Callatostatin-1	8460157#Duve H., Johnsen A.H., Scott A.G., Yu C.G., Yagi K.J., Tobe S.S., Thorpe A.; #Callatostatins: neuropeptides from the blowfly Calliphora vomitoria with sequence homology to cockroach allatostatins.; #Proc. Natl. Acad. Sci. U.S.A. 90:2456-2460(1993).
NP00515	LNEERRANRYGFGL	14	Calliphora vomitoria	Allatostatin	Callatostatin-2	8460157#Duve H., Johnsen A.H., Scott A.G., Yu C.G., Yagi K.J., Tobe S.S., Thorpe A.; #Callatostatins: neuropeptides from the blowfly Calliphora vomitoria with sequence homology to cockroach allatostatins.; #Proc. Natl. Acad. Sci. U.S.A. 90:2456-2460(1993).
NP00516	ANRYGFGL	8	Calliphora vomitoria	Allatostatin	Callatostatin-3	8460157#Duve H., Johnsen A.H., Scott A.G., Yu C.G., Yagi K.J., Tobe S.S., Thorpe A.; #Callatostatins: neuropeptides from the blowfly Calliphora vomitoria with sequence homology to cockroach allatostatins.; #Proc. Natl. Acad. Sci. U.S.A. 90:2456-2460(1993).
NP00517	DRPYSFGL	8	Calliphora vomitoria	Allatostatin	Callatostatin-4	8460157#Duve H., Johnsen A.H., Scott A.G., Yu C.G., Yagi K.J., Tobe S.S., Thorpe A.; #Callatostatins: neuropeptides from the blowfly Calliphora vomitoria with sequence homology to cockroach allatostatins.; #Proc. Natl. Acad. Sci. U.S.A. 90:2456-2460(1993).
NP00518	GPPYDFGM	8	Calliphora vomitoria	Allatostatin	Callatostatin-5	8460157#Duve H., Johnsen A.H., Scott A.G., Yu C.G., Yagi K.J., Tobe S.S., Thorpe A.; #Callatostatins: neuropeptides from the blowfly Calliphora vomitoria with sequence homology to cockroach allatostatins.; #Proc. Natl. Acad. Sci. U.S.A. 90:2456-2460(1993).
NP00519	APQPYAFGL	9	Carcinus maenas	Allatostatin	Carcinustatin-10	9461295#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Jaros P.P., Thorpe A.; #Isolation and identification of multiple neuropeptides of the allatostatin superfamily in the shore crab Carcinus maenas.; #Eur. J. Biochem. 250:727-734(1997).
NP00520	ATGQYAFGL	9	Carcinus maenas	Allatostatin	Carcinustatin-11	9461295#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Jaros P.P., Thorpe A.; #Isolation and identification of multiple neuropeptides of the allatostatin superfamily in the shore crab Carcinus maenas.; #Eur. J. Biochem. 250:727-734(1997).
NP00521	PDMYAFGL	8	Carcinus maenas	Allatostatin	Carcinustatin-12	9461295#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Jaros P.P., Thorpe A.; #Isolation and identification of multiple neuropeptides of the allatostatin superfamily in the shore crab Carcinus maenas.; #Eur. J. Biochem. 250:727-734(1997).
NP00522	EYDDMYTEKRPKVYAFGL	18	Carcinus maenas	Allatostatin	Carcinustatin-13	9461295#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Jaros P.P., Thorpe A.; #Isolation and identification of multiple neuropeptides of the allatostatin superfamily in the shore crab Carcinus maenas.; #Eur. J. Biochem. 250:727-734(1997).
NP00523	YSFGL	5	Carcinus maenas	Allatostatin	Carcinustatin-14	9461295#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Jaros P.P., Thorpe A.; #Isolation and identification of multiple neuropeptides of the allatostatin superfamily in the shore crab Carcinus maenas.; #Eur. J. Biochem. 250:727-734(1997).
NP00524	AGPYSFGL	8	Carcinus maenas	Allatostatin	Carcinustatin-15	9461295#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Jaros P.P., Thorpe A.; #Isolation and identification of multiple neuropeptides of the allatostatin superfamily in the shore crab Carcinus maenas.; #Eur. J. Biochem. 250:727-734(1997).
NP00525	GGPYSYGL	8	Carcinus maenas	Allatostatin	Carcinustatin-16	9461295#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Jaros P.P., Thorpe A.; #Isolation and identification of multiple neuropeptides of the allatostatin superfamily in the shore crab Carcinus maenas.; #Eur. J. Biochem. 250:727-734(1997).
NP00526	SGQYSFGL	8	Carcinus maenas	Allatostatin	Carcinustatin-17	9461295#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Jaros P.P., Thorpe A.; #Isolation and identification of multiple neuropeptides of the allatostatin superfamily in the shore crab Carcinus maenas.; #Eur. J. Biochem. 250:727-734(1997).
NP00527	SDMYSFGL	8	Carcinus maenas	Allatostatin	Carcinustatin-18	9461295#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Jaros P.P., Thorpe A.; #Isolation and identification of multiple neuropeptides of the allatostatin superfamily in the shore crab Carcinus maenas.; #Eur. J. Biochem. 250:727-734(1997).
NP00528	APTDMYSFGL	10	Carcinus maenas	Allatostatin	Carcinustatin-19	9461295#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Jaros P.P., Thorpe A.; #Isolation and identification of multiple neuropeptides of the allatostatin superfamily in the shore crab Carcinus maenas.; #Eur. J. Biochem. 250:727-734(1997).
NP00529	EAYAFGL	7	Carcinus maenas	Allatostatin	Carcinustatin-2	9461295#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Jaros P.P., Thorpe A.; #Isolation and identification of multiple neuropeptides of the allatostatin superfamily in the shore crab Carcinus maenas.; #Eur. J. Biochem. 250:727-734(1997).
NP00530	GYEDEDEDRPFYALGLGKRPRTYSFGL	27	Carcinus maenas	Allatostatin	Carcinustatin-20	9461295#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Jaros P.P., Thorpe A.; #Isolation and identification of multiple neuropeptides of the allatostatin superfamily in the shore crab Carcinus maenas.; #Eur. J. Biochem. 250:727-734(1997).
NP00531	EPYAFGL	7	Carcinus maenas	Allatostatin	Carcinustatin-3	9461295#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Jaros P.P., Thorpe A.; #Isolation and identification of multiple neuropeptides of the allatostatin superfamily in the shore crab Carcinus maenas.; #Eur. J. Biochem. 250:727-734(1997).
NP00532	DPYAFGL	7	Carcinus maenas	Allatostatin	Carcinustatin-4	9461295#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Jaros P.P., Thorpe A.; #Isolation and identification of multiple neuropeptides of the allatostatin superfamily in the shore crab Carcinus maenas.; #Eur. J. Biochem. 250:727-734(1997).
NP00533	NPYAFGL	7	Carcinus maenas	Allatostatin	Carcinustatin-5	9461295#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Jaros P.P., Thorpe A.; #Isolation and identification of multiple neuropeptides of the allatostatin superfamily in the shore crab Carcinus maenas.; #Eur. J. Biochem. 250:727-734(1997).
NP00534	YAFGL	5	Carcinus maenas	Allatostatin	Carcinustatin-1	9461295#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Jaros P.P., Thorpe A.; #Isolation and identification of multiple neuropeptides of the allatostatin superfamily in the shore crab Carcinus maenas.; #Eur. J. Biochem. 250:727-734(1997).
NP00535	SPYAFGL	7	Carcinus maenas	Allatostatin	Carcinustatin-6	9461295#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Jaros P.P., Thorpe A.; #Isolation and identification of multiple neuropeptides of the allatostatin superfamily in the shore crab Carcinus maenas.; #Eur. J. Biochem. 250:727-734(1997).
NP00536	ASPYAFGL	8	Carcinus maenas	Allatostatin	Carcinustatin-7	9461295#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Jaros P.P., Thorpe A.; #Isolation and identification of multiple neuropeptides of the allatostatin superfamily in the shore crab Carcinus maenas.; #Eur. J. Biochem. 250:727-734(1997).
NP00537	AGPYAFGL	8	Carcinus maenas	Allatostatin	Carcinustatin-8	9461295#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Jaros P.P., Thorpe A.; #Isolation and identification of multiple neuropeptides of the allatostatin superfamily in the shore crab Carcinus maenas.; #Eur. J. Biochem. 250:727-734(1997).
NP00538	GGPYAFGL	8	Carcinus maenas	Allatostatin	Carcinustatin-9	9461295#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Jaros P.P., Thorpe A.; #Isolation and identification of multiple neuropeptides of the allatostatin superfamily in the shore crab Carcinus maenas.; #Eur. J. Biochem. 250:727-734(1997).
NP00539	SPHYNFGL	8	Cydia pomonella	Allatostatin	Cydiastatin-1	9392829#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Winstanley D., Davey M., East P.D., Thorpe A.; #Lepidopteran peptides of the allatostatin superfamily.; #Peptides 18:1301-1309(1997).
NP00540	AYSYVSEYKRLPVYNFGL	18	Cydia pomonella	Allatostatin	Cydiastatin-2	9392829#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Winstanley D., Davey M., East P.D., Thorpe A.; #Lepidopteran peptides of the allatostatin superfamily.; #Peptides 18:1301-1309(1997).
NP00541	SRPYSFGL	8	Cydia pomonella	Allatostatin	Cydiastatin-3	9392829#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Winstanley D., Davey M., East P.D., Thorpe A.; #Lepidopteran peptides of the allatostatin superfamily.; #Peptides 18:1301-1309(1997).
NP00542	ARPYSFGL	8	Cydia pomonella	Allatostatin	Cydiastatin-4	9392829#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Winstanley D., Davey M., East P.D., Thorpe A.; #Lepidopteran peptides of the allatostatin superfamily.; #Peptides 18:1301-1309(1997).
NP00543	ARGYDFGL	8	Cydia pomonella	Allatostatin	Cydiastatin-5	9392829#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Winstanley D., Davey M., East P.D., Thorpe A.; #Lepidopteran peptides of the allatostatin superfamily.; #Peptides 18:1301-1309(1997).
NP00544	LPLYNFGL	8	Cydia pomonella	Allatostatin	Cydiastatin-6	9392829#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Winstanley D., Davey M., East P.D., Thorpe A.; #Lepidopteran peptides of the allatostatin superfamily.; #Peptides 18:1301-1309(1997).
NP00545	KMYDFGL	7	Cydia pomonella	Allatostatin	Cydiastatin-7	9392829#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Winstanley D., Davey M., East P.D., Thorpe A.; #Lepidopteran peptides of the allatostatin superfamily.; #Peptides 18:1301-1309(1997).
NP00546	ARPYSFGL	8	Delia radicum	Allatostatin	Allatostatin-A1	20869420#Audsley N., Matthews H.J., Down R.E., Weaver R.J.; #Neuropeptides associated with the central nervous system of the cabbage root fly, Delia radicum (L).; #Peptides 32:434-440(2011).$22848525#Zoephel J., Reiher W., Rexer K.-H., Kahnt J., Wegener C.; #"Peptidomics of the agriculturally damaging larval stage of the cabbage root fly Delia radicum (Diptera: Anthomyiidae)."; #PLoS ONE 7:E41543-E41543(2012).
NP00547	NRPYSFGL	8	Delia radicum	Allatostatin	Allatostatin-A2	20869420#Audsley N., Matthews H.J., Down R.E., Weaver R.J.; #Neuropeptides associated with the central nervous system of the cabbage root fly, Delia radicum (L).; #Peptides 32:434-440(2011).$22848525#Zoephel J., Reiher W., Rexer K.-H., Kahnt J., Wegener C.; #"Peptidomics of the agriculturally damaging larval stage of the cabbage root fly Delia radicum (Diptera: Anthomyiidae)."; #PLoS ONE 7:E41543-E41543(2012).
NP00548	VERYAFGL	8	Delia radicum	Allatostatin	Allatostatin-A3	20869420#Audsley N., Matthews H.J., Down R.E., Weaver R.J.; #Neuropeptides associated with the central nervous system of the cabbage root fly, Delia radicum (L).; #Peptides 32:434-440(2011).$22848525#Zoephel J., Reiher W., Rexer K.-H., Kahnt J., Wegener C.; #"Peptidomics of the agriculturally damaging larval stage of the cabbage root fly Delia radicum (Diptera: Anthomyiidae)."; #PLoS ONE 7:E41543-E41543(2012).
NP00549	LPVYNFGL	8	Delia radicum	Allatostatin	Allatostatin-A4	20869420#Audsley N., Matthews H.J., Down R.E., Weaver R.J.; #Neuropeptides associated with the central nervous system of the cabbage root fly, Delia radicum (L).; #Peptides 32:434-440(2011).$22848525#Zoephel J., Reiher W., Rexer K.-H., Kahnt J., Wegener C.; #"Peptidomics of the agriculturally damaging larval stage of the cabbage root fly Delia radicum (Diptera: Anthomyiidae)."; #PLoS ONE 7:E41543-E41543(2012).
NP00550	QVRYRQCYFNPISCF	15	Delia radicum	Allatostatin	Allatostatin-C1	22848525#Zoephel J., Reiher W., Rexer K.-H., Kahnt J., Wegener C.; #Peptidomics of the agriculturally damaging larval stage of the cabbage root fly Delia radicum (Diptera: Anthomyiidae).; #PLoS ONE 7:E41543-E41543(2012).
NP00551	LYDFGL	6	Diploptera punctata	Allatostatin	Allatostatin-1
NP00552	PVNSGRSSGSRFNFGL	16	Diploptera punctata	Allatostatin	Allatostatin-10
NP00553	YPQEHRFSFGL	11	Diploptera punctata	Allatostatin	Allatostatin-11
NP00554	PFNFGL	6	Diploptera punctata	Allatostatin	Allatostatin-12
NP00555	IPMYDFGI	8	Diploptera punctata	Allatostatin	Allatostatin-13
NP00556	AYSYVSEYKRLPVYNFGL	18	Diploptera punctata	Allatostatin	Allatostatin-2	2006179#Pratt G.E., Farnsworth D.E., Fok K.F., Siegel N.R., McCormack A.L., Shabanowitz J., Hunt D.F., Feyereisen R.; #Identity of a second type of allatostatin from cockroach brains: an octadecapeptide amide with a tyrosine-rich address sequence.; #Proc. Natl. Acad. Sci. U.S.A. 88:2412-2416(1991).
NP00557	SKMYGFGL	8	Diploptera punctata	Allatostatin	Allatostatin-3
NP00558	DGRMYSFGL	9	Diploptera punctata	Allatostatin	Allatostatin-4
NP00559	DRLYSFGL	8	Diploptera punctata	Allatostatin	Allatostatin-5	2762309#Woodhead A.P., Stay B., Seidel S.L., Khan M.A., Tobe S.S.; #Primary structure of four allatostatins: neuropeptide inhibitors of juvenile hormone synthesis.; #Proc. Natl. Acad. Sci. U.S.A. 86:5997-6001(1989).
NP00560	ARPYSFGL	8	Diploptera punctata	Allatostatin	Allatostatin-6
NP00561	APSGAQRLYGFGL	13	Diploptera punctata	Allatostatin	Allatostatin-7	2762309# Woodhead A.P., Stay B., Seidel S.L., Khan M.A., Tobe S.S.; #Primary structure of four allatostatins: neuropeptide inhibitors of juvenile hormone synthesis.; # Proc. Natl. Acad. Sci. U.S.A. 86:5997-6001(1989).$2783135#Pratt G.E., Farnsworth D.E., Siegel N.R., Fok K.F., Feyereisen R.; #Identification of an allatostatin from adult Diploptera punctata.; #Biochem. Biophys. Res. Commun. 163:1243-1247(1989).
NP00562	GGSLYSFGL	9	Diploptera punctata	Allatostatin	Allatostatin-8	2762309#Woodhead A.P., Stay B., Seidel S.L., Khan M.A., Tobe S.S.; #Primary structure of four allatostatins: neuropeptide inhibitors of juvenile hormone synthesis.; #Proc. Natl. Acad. Sci. U.S.A. 86:5997-6001(1989).
NP00563	GDGRLYAFGL	10	Diploptera punctata	Allatostatin	Allatostatin-9	2762309#Woodhead A.P., Stay B., Seidel S.L., Khan M.A., Tobe S.S.; #Primary structure of four allatostatins: neuropeptide inhibitors of juvenile hormone synthesis.; #Proc. Natl. Acad. Sci. U.S.A. 86:5997-6001(1989).
NP00564	VERYAFGL	8	Drosophila melanogaster	Allatostatin	Drostatin-1 (Potential)
NP00565	LPVYNFGL	8	Drosophila melanogaster	Allatostatin	Drostatin-2 (Potential)
NP00566	SRPYSFGL	8	Drosophila melanogaster	Allatostatin	Drostatin-3	12171930#Baggerman G., Cerstiaens A., De Loof A., Schoofs L.; #Peptidomics of the larval Drosophila melanogaster central nervous system.; #J. Biol. Chem. 277:40368-40374(2002).
NP00567	TTRPQPFNFGL	11	Drosophila melanogaster	Allatostatin	Drostatin-4	12171930#Baggerman G., Cerstiaens A., De Loof A., Schoofs L.; #Peptidomics of the larval Drosophila melanogaster central nervous system.; #J. Biol. Chem. 277:40368-40374(2002).
NP00568	AYMYTNGGPGM	11	Drosophila melanogaster	Allatostatin	Drostatin-5	12171930#Baggerman G., Cerstiaens A., De Loof A., Schoofs L.; #Peptidomics of the larval Drosophila melanogaster central nervous system.; #J. Biol. Chem. 277:40368-40374(2002).
NP00569	AWQSLQSSW	9	Drosophila melanogaster	Allatostatin	Drostatin-B1 (Potential)
NP00570	AWKSMNVAW	9	Drosophila melanogaster	Allatostatin	Drostatin-B2	12171930#Baggerman G., Cerstiaens A., De Loof A., Schoofs L.; #Peptidomics of the larval Drosophila melanogaster central nervous system.; #J. Biol. Chem. 277:40368-40374(2002).
NP00571	RQAQGWNKFRGAW	13	Drosophila melanogaster	Allatostatin	Drostatin-B3 (Potential)	20575072#Carlsson MA, Diesner M, Schachtner J, Nässel DR#Multiple neuropeptides in the Drosophila antennal lobe suggest complex modulatory circuits#J Comp Neurol 2010 Aug 15;518(16):3359-80
NP00572	EPTWNNLKGMW	11	Drosophila melanogaster	Allatostatin	Drostatin-B4 (Potential)
NP00573	DQWQKLHGGW	10	Drosophila melanogaster	Allatostatin	Drostatin-B5	12171930#Baggerman G., Cerstiaens A., De Loof A., Schoofs L.; #Peptidomics of the larval Drosophila melanogaster central nervous system.; #J. Biol. Chem. 277:40368-40374(2002).$20575072#Carlsson MA, Diesner M, Schachtner J, Nässel DR#Multiple neuropeptides in the Drosophila antennal lobe suggest complex modulatory circuits#J Comp Neurol 2010 Aug 15;518(16):3359-80
NP00574	SPHYDFGL	8	Helicoverpa armigera	Allatostatin	Helicostatin-1	9392829#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Winstanley D., Davey M., East P.D., Thorpe A.; #Lepidopteran peptides of the allatostatin superfamily.; #Peptides 18:1301-1309(1997).
NP00575	AYSYVSEYKRLPVYNFGL	18	Helicoverpa armigera	Allatostatin	Helicostatin-2a	9392829#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Winstanley D., Davey M., East P.D., Thorpe A.; #Lepidopteran peptides of the allatostatin superfamily.; #Peptides 18:1301-1309(1997).
NP00576	LPVYNFGL	8	Helicoverpa armigera	Allatostatin	Helicostatin-2b
NP00577	SRPYSFGL	8	Helicoverpa armigera	Allatostatin	Helicostatin-3	9392829#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Winstanley D., Davey M., East P.D., Thorpe A.; #Lepidopteran peptides of the allatostatin superfamily.; #Peptides 18:1301-1309(1997).
NP00578	ARPYSFGL	8	Helicoverpa armigera	Allatostatin	Helicostatin-4	9392829#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Winstanley D., Davey M., East P.D., Thorpe A.; #Lepidopteran peptides of the allatostatin superfamily.; #Peptides 18:1301-1309(1997).
NP00579	ARAYDFGL	8	Helicoverpa armigera	Allatostatin	Helicostatin-5	9392829#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Winstanley D., Davey M., East P.D., Thorpe A.; #Lepidopteran peptides of the allatostatin superfamily.; #Peptides 18:1301-1309(1997).
NP00580	LPMYNFGL	8	Helicoverpa armigera	Allatostatin	Helicostatin-6	9392829#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Winstanley D., Davey M., East P.D., Thorpe A.; #Lepidopteran peptides of the allatostatin superfamily.; #Peptides 18:1301-1309(1997).
NP00581	ARSYNFGL	8	Helicoverpa armigera	Allatostatin	Helicostatin-7	9392829#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Winstanley D., Davey M., East P.D., Thorpe A.; #Lepidopteran peptides of the allatostatin superfamily.; #Peptides 18:1301-1309(1997).
NP00582	YSKFNFGL	8	Helicoverpa armigera	Allatostatin	Helicostatin-8	9392829#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Winstanley D., Davey M., East P.D., Thorpe A.; #Lepidopteran peptides of the allatostatin superfamily.; #Peptides 18:1301-1309(1997).
NP00583	ERDMHRFSFGL	11	Helicoverpa armigera	Allatostatin	Helicostatin-9	9392829#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Winstanley D., Davey M., East P.D., Thorpe A.; #Lepidopteran peptides of the allatostatin superfamily.; #Peptides 18:1301-1309(1997).
NP00584	AWQDLNAGW	9	Locusta migratoria	Allatostatin	Locustamyoinhibiting peptide	1796179#Schoofs L., Holman G.M., Hayes T.K., Nachman R.J., de Loof A.; #Isolation, identification and synthesis of locustamyoinhibiting peptide (LOM-MIP), a novel biologically active neuropeptide from Locusta migratoria.; #Regul. Pept. 36:111-119(1991).
NP00585	QVRFRQCYFNPISCF	15	Manduca sexta	Allatostatin	Allatostatin	1946359#Kramer S.J., Toschi A., Miller C.A., Kataoka H., Quistad G.B., Li J.P., Carney R.L., Schooley D.A.; #Identification of an allatostatin from the tobacco hornworm Manduca sexta.; #Proc. Natl. Acad. Sci. U.S.A. 88:9458-9462(1991).
NP00586	LPVYNFGL	8	Rhodnius prolixus	Allatostatin	Allatostatin-1	19137558#Ons S., Richter F., Urlaub H., Pomar R.R.; #The neuropeptidome of Rhodnius prolixus brain.; #Proteomics 9:788-792(2009).
NP00587	MRNYSFGL	8	Rhodnius prolixus	Allatostatin	Allatostatin-2	19137558#Ons S., Richter F., Urlaub H., Pomar R.R.; #The neuropeptidome of Rhodnius prolixus brain.; #Proteomics 9:788-792(2009).
NP00588	QVSLKYPEGKMYSFGL	16	Rhodnius prolixus	Allatostatin	Allatostatin-3	19137558#Ons S., Richter F., Urlaub H., Pomar R.R.; #The neuropeptidome of Rhodnius prolixus brain.; #Proteomics 9:788-792(2009).
NP00589	QVRFRQCYFNPISCF	15	Spodoptera frugiperda	Allatostatin	Allatostatin (By similarity)
NP00590	SYWKQCAFNAVSCF	14	Apis mellifera	Allatostatin	Allatostatin C	19576913#Boerjan B, Cardoen D, Bogaerts A, Landuyt B, Schoofs L, Verleyen P#Mass spectrometric profiling of (neuro)-peptides in the worker honeybee, Apis mellifera#Neuropharmacology 2010 Jan;58(1):248-58 $17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J.,Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L.,Robinson G.E., Sweedler J.V.#From the genome to the proteome: uncovering peptides in the Apis brain.#Science 314:647-649(2006).
NP00591	LRNQLDIGDL	10	Apis mellifera	Allatostatin	LRNQLDIGDLQ–allatostatinC	19576913#Boerjan B, Cardoen D, Bogaerts A, Landuyt B, Schoofs L, Verleyen P#Mass spectrometric profiling of (neuro)-peptides in the worker honeybee, Apis mellifera#Neuropharmacology 2010 Jan;58(1):248-58 $17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J.,Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L.,Robinson G.E., Sweedler J.V.#From the genome to the proteome: uncovering peptides in the Apis brain.#Science 314:647-649(2006).
NP00592	LRNQLDIGDLQ	11	Apis mellifera	Allatostatin	LRNQLDIGDLQ–allatostatinC	19576913#Boerjan B, Cardoen D, Bogaerts A, Landuyt B, Schoofs L, Verleyen P#Mass spectrometric profiling of (neuro)-peptides in the worker honeybee, Apis mellifera#Neuropharmacology 2010 Jan;58(1):248-58 $17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J.,Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L.,Robinson G.E., Sweedler J.V.#From the genome to the proteome: uncovering peptides in the Apis brain.#Science 314:647-649(2006).
NP00593	AQHQYSFGL	9	Gryllus bimaculatus	Allatostatin	Allatostatin 1	7673141#Lorenz MW, Kellner R, Hoffmann KH#A family of neuropeptides that inhibit juvenile hormone biosynthesis in the cricket, Gryllus bimaculatus#J Biol Chem 1995 Sep 8;270(36):21103-8
NP00594	AGGRQYGFGL	10	Gryllus bimaculatus	Allatostatin	Allatostatin-2	7673141#Lorenz MW, Kellner R, Hoffmann KH#A family of neuropeptides that inhibit juvenile hormone biosynthesis in the cricket, Gryllus bimaculatus#J Biol Chem 1995 Sep 8;270(36):21103-8
NP00595	NYWRQCAFNAVSCF	14	Nasonia vitripennis	Allatostatin	Allatostatin-C	20695486#Hauser F, Neupert S, Williamson M, Predel R, Tanaka Y, Grimmelikhuijzen CJ#Genomics and peptidomics of neuropeptides and protein hormones present in the parasitic wasp Nasonia vitripennis#J Proteome Res 2010 Oct 1;9(10):5296-310
NP00596	GQAKGRVYWRCYFNAVTCF	19	Nasonia vitripennis	Allatostatin	Allatostatin-CC	20695486#Hauser F, Neupert S, Williamson M, Predel R, Tanaka Y, Grimmelikhuijzen CJ#Genomics and peptidomics of neuropeptides and protein hormones present in the parasitic wasp Nasonia vitripennis#J Proteome Res 2010 Oct 1;9(10):5296-310