Total number of results for Insulin are 207
Download
as Fasta All
NPID | Sequence | Length | Organism | Family | Name | PMID | Peptide_REF |
---|---|---|---|---|---|---|---|
NP02590 |
QSRPSIVCECCFNQCTVQELLAYC
|
24 | Lymnaea stagnalis | Insulin | Molluscan insulin-related peptide | 1572366#Li KW, Geraerts WP#Isolation and chemical characterization of a novel insulin-related neuropeptide from the freshwater snail, Lymnaea stagnalis#Eur J Biochem 1992 Apr 15;205(2):675-8 Erratum in: Eur J Biochem 1993 Mar 15;212(3):839 | |
NP02591 |
NAETDLDDPLRNIKLSSESALTYLY
|
25 | Lymnaea stagnalis | Insulin | Molluscan insulin-related peptide I | 1526314#Li KW, Geraerts WP, Ebberink RH, Joosse J#Purification and sequencing of molluscan insulin-related peptide I (MIP I) from the neuroendocrine light green cells of Lymnaea stagnalis#Mol Cell Endocrinol 1992 May;85(1-2):141-50 | |
NP02592 |
QPSACNINDRPHRRGVCGSALADLVDPACSSSNGPA
|
36 | Lymnaea stagnalis | Insulin | Molluscan insulin-related peptide I | 1526314#Li KW, Geraerts WP, Ebberink RH, Joosse J#Purification and sequencing of molluscan insulin-related peptide I (MIP I) from the neuroendocrine light green cells of Lymnaea stagnalis#Mol Cell Endocrinol 1992 May;85(1-2):141-50 | |
NP02593 |
QSSCSLSSRPHPRGICGSNLAGFRAFICSNQNSPS
|
35 | Lymnaea stagnalis | Insulin | Molluscan insulin-related peptide II | 1350761#Li KW, Geraerts WP, Joosse J#Purification and sequencing of molluscan insulin-related peptide II from the neuroendocrine light green cells in Lymnaea stagnalis#Endocrinology 1992 Jun;130(6):3427-32 | |
NP02594 |
NFEHSCNGYMRPHPRGLCGEDLHVIISNLCSSLGGNRRFLAKYMVKRDTENVNDKLRGILLNKKEAFSYLTKREASGSITCECCFNQCRIFELAQYCRLPDHFFSRISRTGRSNSGHAQLEDNFS
|
125 | Aplysia californica | Insulin | Insulin | ||
NP02595 |
EASGSITCECCFNQCRIFELAQYCRLPDHFFSRIS
|
35 | Aplysia californica | Insulin | Insulin A chain | 10479677#Floyd P.D., Li L., Rubakhin S.S., Sweedler J.V., Horn C.C., Kupfermann I., Alexeeva V.Y., Ellis T.A., Dembrow N.C., Weiss K.R., Vilim F.S.; #Insulin prohormone processing, distribution, and relation to metabolism in Aplysia californica.; #J. Neurosci. 19:7732-7741(1999). | |
NP02596 |
NFEHSCNGYMRPHPRGLCGEDLHVIISNLCSSLGGNRRFLAKYMV
|
45 | Aplysia californica | Insulin | Insulin B chain | 10479677#Floyd P.D., Li L., Rubakhin S.S., Sweedler J.V., Horn C.C., Kupfermann I., Alexeeva V.Y., Ellis T.A., Dembrow N.C., Weiss K.R., Vilim F.S.; #Insulin prohormone processing, distribution, and relation to metabolism in Aplysia californica.; #J. Neurosci. 19:7732-7741(1999). | |
NP02597 |
NFEHSCNGYMRPHPRGLCGEDLHVIISNLCSSLGGNRRFLA
|
41 | Aplysia californica | Insulin | Insulin B chain' | 10479677#Floyd P.D., Li L., Rubakhin S.S., Sweedler J.V., Horn C.C., Kupfermann I., Alexeeva V.Y., Ellis T.A., Dembrow N.C., Weiss K.R., Vilim F.S.; #Insulin prohormone processing, distribution, and relation to metabolism in Aplysia californica.; #J. Neurosci. 19:7732-7741(1999). | |
NP02598 |
GVFDECCRKSCSISELQTYCG
|
21 | Locusta migratoria | Insulin | insulin-related peptide | 1935945#Hetru C, Li KW, Bulet P, Lagueux M, Hoffmann JA#Isolation and structural characterization of an insulin-related molecule, a predominant neuropeptide from Locusta migratoria#Eur J Biochem 1991 Oct 15;201(2):495-9 | |
NP02599 |
SGAPQPVARYCGEKLSNALKLVCRGNYNTMF
|
31 | Locusta migratoria | Insulin | insulin-related peptide | 1935945#Hetru C, Li KW, Bulet P, Lagueux M, Hoffmann JA#Isolation and structural characterization of an insulin-related molecule, a predominant neuropeptide from Locusta migratoria#Eur J Biochem 1991 Oct 15;201(2):495-9 | |
NP02600 |
QGTTNIVCECCMKPCTLSELRQYCP
|
25 | Lymnaea stagnalis | Insulin | Molluscan insulin-related peptide I | 1526314#Li KW, Geraerts WP, Ebberink RH, Joosse J#Purification and sequencing of molluscan insulin-related peptide I (MIP I) from the neuroendocrine light green cells of Lymnaea stagnalis#Mol Cell Endocrinol 1992 May;85(1-2):141-50 | |
NP02601 |
QRTTNLVCECCFNYCTPDVVRKYCY
|
25 | Lymnaea stagnalis | Insulin | Molluscan insulin-related peptide II | 1350761#Li KW, Geraerts WP, Joosse J#Purification and sequencing of molluscan insulin-related peptide II from the neuroendocrine light green cells in Lymnaea stagnalis#Endocrinology 1992 Jun;130(6):3427-32 | |
NP02602 |
TTQHTCSILSRPHPRGLCGSTLANMVQWLCSTYTTSS
|
37 | Lymnaea stagnalis | Insulin | Molluscan insulin-related peptide III | 1572366#Li KW, Geraerts WP#Isolation and chemical characterization of a novel insulin-related neuropeptide from the freshwater snail, Lymnaea stagnalis#Eur J Biochem 1992 Apr 15;205(2):675-8 Erratum in: Eur J Biochem 1993 Mar 15;212(3):839 | |
NP02603 |
AANQHLCGSHLVEALYLVCGERGFFYTPNKV
|
31 | Acipenser gueldenstaedtii | Insulin | Insulin B chain | 9650713#Rusakov Y.I., Moriyama S., Bondareva V.M., Kolychev A.P., Amemiya Y., Yasuda A., Kawauchi H.#Isolation and characterization of insulin in Russian sturgeon (Acipenser guldenstaedti).# J. Pept. Res. 51:395-400(1998). | |
NP02604 |
GIVEQCCHSPCSLYDLENYCN
|
21 | Acipenser gueldenstaedtii | Insulin | Insulin A chain | 9650713#Rusakov Y.I., Moriyama S., Bondareva V.M., Kolychev A.P., Amemiya Y., Yasuda A., Kawauchi H.#Isolation and characterization of insulin in Russian sturgeon (Acipenser guldenstaedti).# J. Pept. Res. 51:395-400(1998). | |
NP02605 |
FVBQHLCGSHLVEALYLVCGERGFFYTPKS
|
30 | Acomys cahirinus | Insulin | Insulin B chain | 5028210#Buenzli H.F., Humbel R.E.#Isolation and partial structural analysis of insulin from mouse (Mus musculus) and spiny mouse (Acomys cahirinus).# Hoppe-Seyler's Z. Physiol. Chem. 353:444-450(1972). | |
NP02606 |
GIVDQCCTSICSLYQLENYCN
|
21 | Acomys cahirinus | Insulin | Insulin A chain | 5028210#Buenzli H.F., Humbel R.E.#Isolation and partial structural analysis of insulin from mouse (Mus musculus) and spiny mouse (Acomys cahirinus).# Hoppe-Seyler's Z. Physiol. Chem. 353:444-450(1972). | |
NP02607 |
GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
|
70 | Ailuropoda melanoleuca | Insulin | Insulin-like growth factor I | ||
NP02608 |
GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
|
70 | Ailurus fulgens | Insulin | Insulin-like growth factor I | ||
NP02609 |
AANQHLCGSHLVEALYLVCGERGFFYSPKT
|
30 | Anas platyrhynchos | Insulin | Insulin B chain | 4763354#Markussen J., Sundby F.#Duck insulin: isolation, crystallization and amino acid sequence.# Int. J. Pept. Protein Res. 5:37-48(1973). | |
NP02610 |
GIVEQCCENPCSLYQLENYCN
|
21 | Anas platyrhynchos | Insulin | Insulin A chain | 4763354#Markussen J., Sundby F.#Duck insulin: isolation, crystallization and amino acid sequence.# Int. J. Pept. Protein Res. 5:37-48(1973). | |
NP02611 |
AANQHLCGSHLVEALYLVCGERGFFYSPKT
|
30 | Anser anser anser | Insulin | Insulin B chain | #Xu Y., Lin N., Zhang Y., Zhang Y.#Isolation and sequence determination of goose insulin.# Kexue Tongbao 28:966-968(1983). | |
NP02612 |
GIVEQCCENPCSLYQLENYCN
|
21 | Anser anser anser | Insulin | Insulin A chain | #Xu Y., Lin N., Zhang Y., Zhang Y.#Isolation and sequence determination of goose insulin.# Kexue Tongbao 28:966-968(1983). | |
NP02613 |
FVNQHLCGPHLVEALYLVCGERGFFYAPKT
|
30 | Aotus trivirgatus | Insulin | Insulin B chain | ||
NP02614 |
GVVDQCCTSICSLYQLQNYCN
|
21 | Aotus trivirgatus | Insulin | Insulin A chain | ||
NP02615 |
FVNQHLCGSHLVEALYLVCGERGFFYTPKA
|
30 | Balaenoptera borealis | Insulin | Insulin B chain | 13552701#Ishihara Y., Saito T., Ito Y., Fujino M.#Structure of sperm- and sei-whale insulins and their breakdown by whale pepsin.# Nature 181:1468-1469(1958). | |
NP02616 |
GIVEQCCASTCSLYQLENYCN
|
21 | Balaenoptera borealis | Insulin | Insulin A chain | 13552701#Ishihara Y., Saito T., Ito Y., Fujino M.#Structure of sperm- and sei-whale insulins and their breakdown by whale pepsin.# Nature 181:1468-1469(1958). | |
NP02617 |
FVNQHLCGSHLVEALYLVCGERGFFYTPKA
|
30 | Balaenoptera physalus | Insulin | Insulin B chain | 14228503#Hama H., Titani K., Sakaki S., Narita K.#The amino acid sequence in fin-whale insulin.# J. Biochem. 56:285-293(1964). | |
NP02618 |
GIVEQCCTSICSLYQLENYCN
|
21 | Balaenoptera physalus | Insulin | Insulin A chain | 14228503#Hama H., Titani K., Sakaki S., Narita K.#The amino acid sequence in fin-whale insulin.# J. Biochem. 56:285-293(1964). | |
NP02619 |
AANQHLCGSHLVEALYLVCGERGFFYSPKT
|
30 | Cairina moschata | Insulin | Insulin B chain | 8759296#Chevalier B., Anglade P., Derouet M., Molle D., Simon J.#Isolation and characterization of Muscovy (Cairna moschata) duck insulin.# Comp. Biochem. Physiol. 114B:19-26(1996). | |
NP02620 |
GIVEQCCENPCSLYQLENYCN
|
21 | Cairina moschata | Insulin | Insulin A chain | 8759296#Chevalier B., Anglade P., Derouet M., Molle D., Simon J.#Isolation and characterization of Muscovy (Cairna moschata) duck insulin.# Comp. Biochem. Physiol. 114B:19-26(1996). | |
NP02621 |
VPTQRLCGSHLVDALYFVCGERGFFYSPKQI
|
31 | Callorhynchus milii | Insulin | Insulin B chain | 2690815#Berks B.C., Marshall C.J., Carne A., Galloway S.M., Cutfield J.F.#Isolation and structural characterization of insulin and glucagon from the holocephalan species Callorhynchus milii (elephantfish).# Biochem. J. 263:261-266(1989). | |
NP02622 |
GIVEQCCHNTCSLVNLEGYCN
|
21 | Callorhynchus milii | Insulin | Insulin A chain | 2690815#Berks B.C., Marshall C.J., Carne A., Galloway S.M., Cutfield J.F.#Isolation and structural characterization of insulin and glucagon from the holocephalan species Callorhynchus milii (elephantfish).# Biochem. J. 263:261-266(1989). | |
NP02623 |
FANQHLCGSHLVEALYLVCGERGFFYTPKA
|
30 | Camelus dromedarius | Insulin | Insulin B chain | #Danho W.O.#The isolation and characterization of insulin of camel (Camelus dromedarius).# J. Fac. Med. Baghdad 14:16-28(1972). | |
NP02624 |
GIVEQCCASVCSLYQLENYCN
|
21 | Camelus dromedarius | Insulin | Insulin A chain | #Danho W.O.#The isolation and characterization of insulin of camel (Camelus dromedarius).# J. Fac. Med. Baghdad 14:16-28(1972). | |
NP02625 |
GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
|
70 | Canis familiaris | Insulin | Insulin-like growth factor I | ||
NP02626 |
FVNQHLCGSHLVEALYLVCGERGFFYTPKA
|
30 | Canis familiaris | Insulin | Insulin B chain | 5949593#Smith L.F.#Species variation in the amino acid sequence of insulin.# Am. J. Med. 40:662-666(1966). | |
NP02627 |
GIVEQCCTSICSLYQLENYCN
|
21 | Canis familiaris | Insulin | Insulin A chain | 5949593#Smith L.F.#Species variation in the amino acid sequence of insulin.# Am. J. Med. 40:662-666(1966). | |
NP02628 |
TDDKKLKACGRDYVRLQIEVCGSIWWGRKAGQLRE
|
35 | Canis familiaris | Insulin | Relaxin B chain | 1388669#Stewart D.R., Henzel W.J., Vandlen R.#Purification and sequence determination of canine relaxin.# J. Protein Chem. 11:247-253(1992). | |
NP02629 |
DNYIKMSDKCCNVGCTRRELASRC
|
24 | Canis familiaris | Insulin | Relaxin A chain | 1388669#Stewart D.R., Henzel W.J., Vandlen R.#Purification and sequence determination of canine relaxin.# J. Protein Chem. 11:247-253(1992). | |
NP02630 |
GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPTKSA
|
70 | Capra hircus | Insulin | Insulin-like growth factor I | ||
NP02631 |
FVNQHLCGSHLVEALYLVCGERGFFYTPKA
|
30 | Capra hircus | Insulin | Insulin B chain | 5949593#Smith L.F.#Species variation in the amino acid sequence of insulin.# Am. J. Med. 40:662-666(1966). | |
NP02632 |
GIVEQCCAGVCSLYQLENYCN
|
21 | Capra hircus | Insulin | Insulin A chain | 5949593#Smith L.F.#Species variation in the amino acid sequence of insulin.# Am. J. Med. 40:662-666(1966). | |
NP02633 |
GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
|
70 | Cavia porcellus | Insulin | Insulin-like growth factor I | ||
NP02634 |
AYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRSCDLALLETYCATPAKSE
|
67 | Cavia porcellus | Insulin | Insulin-like growth factor II | ||
NP02635 |
DVSASLAVLPDNFPRYPVGKFFQYDTWRQSTQRL
|
34 | Cavia porcellus | Insulin | Preptin | ||
NP02636 |
FVSRHLCGSNLVETLYSVCQDDGFFYIPKD
|
30 | Cavia porcellus | Insulin | Insulin B chain | 5949593#Smith L.F.#Species variation in the amino acid sequence of insulin.# Am. J. Med. 40:662-666(1966). | |
NP02637 |
GIVDQCCTGTCTRHQLQSYCN
|
21 | Cavia porcellus | Insulin | Insulin A chain | 5949593#Smith L.F.#Species variation in the amino acid sequence of insulin.# Am. J. Med. 40:662-666(1966). | |
NP02638 |
GFLDKVIKVCGRDLVRIKIDICGKILLGDMTTG
|
33 | Cavia porcellus | Insulin | Relaxin B chain (By similarity) | ||
NP02639 |
QLDMTVSEKCCQVGCTRRFIANSC
|
24 | Cavia porcellus | Insulin | Relaxin A chain (By similarity) | ||
NP02640 |
FVNKHLCGSHLVDALYLVCGDRGFFYTPMA
|
30 | Chinchilla chinchilla | Insulin | Insulin B chain | 1175610#Wood S.P., Blundell T.L., Wollmer A., Lazarus N.R., Neville R.W.J.#The relation of conformation and association of insulin to receptor binding; X-ray and circular-dichroism studies on bovine and hystricomorph insulins.# Eur. J. Biochem. 55:531-542(1975). | |
NP02641 |
GIVDQCCTSICTLYQLENYCN
|
21 | Chinchilla chinchilla | Insulin | Insulin A chain | 1175610#Wood S.P., Blundell T.L., Wollmer A., Lazarus N.R., Neville R.W.J.#The relation of conformation and association of insulin to receptor binding; X-ray and circular-dichroism studies on bovine and hystricomorph insulins.# Eur. J. Biochem. 55:531-542(1975). | |
NP02642 |
FVNQHLCGSHLVEALYLVCGERGFFYTPKT
|
30 | Chlorocebus aethiops | Insulin | Insulin B chain | 4626369#Peterson J.D., Nehrlich S., Oyer P.E., Steiner D.F.#Determination of the amino acid sequence of the monkey, sheep, and dog proinsulin C-peptides by a semi-micro Edman degradation procedure.# J. Biol. Chem. 247:4866-4871(1972). | |
NP02643 |
GIVEQCCTSICSLYQLENYCN
|
21 | Chlorocebus aethiops | Insulin | Insulin A chain | 4626369#Peterson J.D., Nehrlich S., Oyer P.E., Steiner D.F.#Determination of the amino acid sequence of the monkey, sheep, and dog proinsulin C-peptides by a semi-micro Edman degradation procedure.# J. Biol. Chem. 247:4866-4871(1972). | |
NP02644 |
GPETLCGAELVDALQFVCGDRGFYFSKPTGYGSSSRRLHHKGIVDECCFQSCDLRRLEMYCAPIKPPKSA
|
70 | Coturnix coturnix japonica | Insulin | Insulin-like growth factor I | ||
NP02645 |
FVNQHLCGSHLVEALYLVCGERGFFYTPKS
|
30 | Cricetulus longicaudatus | Insulin | Insulin B chain | #Neelon F.A., Delcher H.K., Steinman H., Lebovitz H.E.#Structure of hamster insulin: comparison with a tumor insulin.# Fed. Proc. 32:300-300(1973). | |
NP02646 |
GIVDQCCTSICSLYQLENYCN
|
21 | Cricetulus longicaudatus | Insulin | Insulin A chain | #Neelon F.A., Delcher H.K., Steinman H., Lebovitz H.E.#Structure of hamster insulin: comparison with a tumor insulin.# Fed. Proc. 32:300-300(1973). | |
NP02647 |
GPETLCGAELVDTLQFVCGDRGFYFSKPTGYGPSSRRSHNRGIVDECCFQSCELRRLEMYCAPVKPGKTP
|
70 | Cyprinus carpio | Insulin | Insulin-like growth factor I, adult form | ||
NP02648 |
NAGAPQHLCGSHLVDALYLVCGPTGFFYNP
|
30 | Cyprinus carpio | Insulin | Insulin B chain | 7037403#Makower A., Dettmer R., Rapoport T.A., Knospe S., Behlke J., Prehn S., Franke P., Etzold G., Rosenthal S.#Carp insulin: amino acid sequence, biological activity and structural properties.# Eur. J. Biochem. 122:339-345(1982). | |
NP02649 |
GIVEQCCHKPCSIFELQNYCN
|
21 | Cyprinus carpio | Insulin | Insulin A chain | 7037403#Makower A., Dettmer R., Rapoport T.A., Knospe S., Behlke J., Prehn S., Franke P., Etzold G., Rosenthal S.#Carp insulin: amino acid sequence, biological activity and structural properties.# Eur. J. Biochem. 122:339-345(1982). | |
NP02650 |
NPGTPQHLCGSHLVDALYLVCGPTGFFYNP
|
30 | Danio rerio | Insulin | Insulin B chain | ||
NP02651 |
GIVEQCCHKPCSIFELQNYCN
|
21 | Danio rerio | Insulin | Insulin A chain | ||
NP02652 |
LVNQHLCGSHLVEALYLVCGERGFFYTPKA
|
30 | Didelphis virginiana | Insulin | Insulin B chain | 2695899#Yu J.-H., Eng J., Rattan S., Yalow R.S.#Opossum insulin, glucagon and pancreatic polypeptide: amino acid sequences.# Peptides 10:1195-1197(1989). | |
NP02653 |
GIVEQCCNSICSLYQLETYCN
|
21 | Didelphis virginiana | Insulin | Insulin A chain | 2695899#Yu J.-H., Eng J., Rattan S., Yalow R.S.#Opossum insulin, glucagon and pancreatic polypeptide: amino acid sequences.# Peptides 10:1195-1197(1989). | |
NP02654 |
FVNQHLCGSHLVEALYLVCGERGFFYTPKT
|
30 | Elephas maximus | Insulin | Insulin B chain | 5949593#Smith L.F.#Species variation in the amino acid sequence of insulin.# Am. J. Med. 40:662-666(1966). | |
NP02655 |
GIVEQCCTGVCSLYQLENYCN
|
21 | Elephas maximus | Insulin | Insulin A chain | 5949593#Smith L.F.#Species variation in the amino acid sequence of insulin.# Am. J. Med. 40:662-666(1966). | |
NP02656 |
GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
|
70 | Equus caballus | Insulin | Insulin-like growth factor I | ||
NP02657 |
AYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRINRRSRGIVEECCFRSCDLALLETYCATPAKSE
|
67 | Equus caballus | Insulin | Insulin-like growth factor II | ||
NP02658 |
DVSTPPTVLPDDSPRYPVVKLFQYNAWKQSTQRL
|
34 | Equus caballus | Insulin | Preptin | ||
NP02659 |
FVNQHLCGSHLVEALYLVCGERGFFYTPKA
|
30 | Equus caballus | Insulin | Insulin B chain | 13373434#Harris J.I., Sanger F., Naughton M.A.#Species differences in insulin.# Arch. Biochem. Biophys. 65:427-438(1956). | |
NP02660 |
GIVEQCCTGICSLYQLENYCN
|
21 | Equus caballus | Insulin | Insulin A chain | 13373434#Harris J.I., Sanger F., Naughton M.A.#Species differences in insulin.# Arch. Biochem. Biophys. 65:427-438(1956). | |
NP02661 |
QKPDDVIKACGRELARLRIEICGSLSWK
|
28 | Equus caballus | Insulin | Relaxin B chain | 2055195#Stewart D.R., Nevins B., Hadas E., Vandlen R.#Affinity purification and sequence determination of equine relaxin.# Endocrinology 129:375-383(1991). | |
NP02662 |
QLSHKCCYWGCTRKELARQC
|
20 | Equus caballus | Insulin | Relaxin A chain | 2055195#Stewart D.R., Nevins B., Hadas E., Vandlen R.#Affinity purification and sequence determination of equine relaxin.# Endocrinology 129:375-383(1991). | |
NP02663 |
FVNQHLCGSHLVEALYLVCGERGFFYTPKA
|
30 | Felis catus | Insulin | Insulin B chain | 3518635#Hallden G., Gafvelin G., Mutt V., Joernvall H.#Characterization of cat insulin.# Arch. Biochem. Biophys. 247:20-27(1986). | |
NP02664 |
GIVEQCCASVCSLYQLEHYCN
|
21 | Felis catus | Insulin | Insulin A chain | 3518635#Hallden G., Gafvelin G., Mutt V., Joernvall H.#Characterization of cat insulin.# Arch. Biochem. Biophys. 247:20-27(1986). | |
NP02665 |
QEEVLKACGREFVRLQIRICGSLSWG
|
26 | Felis catus | Insulin | Relaxin B chain (By similarity) | ||
NP02666 |
SDYIRYSDRCCNVGCTRKELADLC
|
24 | Felis catus | Insulin | Relaxin A chain (By similarity) | ||
NP02667 |
GPETLCGAELVDALQFVCGDRGFYFSKPTGYGSSSRRLHHKGIVDECCFQSCDLRRLEMYCAPIKPPKSA
|
70 | Gallus gallus | Insulin | Insulin-like growth factor I | 2272467#Ballard F.J., Johnson R.J., Owens P.C., Francis G.L., Upton F.M., McMurtry J.P., Wallace J.C.#Chicken insulin-like growth factor-I: amino acid sequence, radioimmunoassay, and plasma levels between strains and during growth.# Gen. Comp. Endocrinol. 79:459-468(1990). | |
NP02668 |
AYGTAETLCGGELVDTLQFVCGDRGFYFSRPVGRNNRRINRGIVEECCFRSCDLALLETYCAKSVKSE
|
68 | Gallus gallus | Insulin | Insulin-like growth factor II | 1688912#Kallincos N.C., Wallace J.C., Francis G.L., Ballard F.J.#Chemical and biological characterization of chicken insulin-like growth factor-II.# J. Endocrinol. 124:89-97(1990).$3379351#Dawe S.R., Francis G.L., McNamara P.J., Wallace J.C., Ballard F.J.#Purification, partial sequences and properties of chicken insulin-like growth factors.#J. Endocrinol. 117:173-181(1988). | |
NP02669 |
AANQHLCGSHLVEALYLVCGERGFFYSPKA
|
30 | Gallus gallus | Insulin | Insulin B chain | 5949593#Smith L.F.#Species variation in the amino acid sequence of insulin.# Am. J. Med. 40:662-666(1966). | |
NP02670 |
GIVEQCCHNTCSLYQLENYCN
|
21 | Gallus gallus | Insulin | Insulin A chain | 5949593#Smith L.F.#Species variation in the amino acid sequence of insulin.# Am. J. Med. 40:662-666(1966). | |
NP02671 |
FVNQHLCGSHLVEALYLVCGERGFFYTPKT
|
30 | Gorilla gorilla gorilla | Insulin | Insulin B chain | ||
NP02672 |
GIVEQCCTSICSLYQLENYCN
|
21 | Gorilla gorilla gorilla | Insulin | Insulin A chain | ||
NP02673 |
FVNQHLCGSHLVEALYLVCGNDGFFYRPKA
|
30 | Hystrix cristata | Insulin | Insulin B chain | 6995860#Horuk R., Blundell T.L., Lazarus N.R., Neville R.W.J., Stone D., Wollmer A.#A monomeric insulin from the porcupine (Hystrix cristata), an Old World hystricomorph.# Nature 286:822-824(1980). | |
NP02674 |
GIVDQCCTGVCSLYQLQNYCN
|
21 | Hystrix cristata | Insulin | Insulin A chain | 6995860#Horuk R., Blundell T.L., Lazarus N.R., Neville R.W.J., Stone D., Wollmer A.#A monomeric insulin from the porcupine (Hystrix cristata), an Old World hystricomorph.# Nature 286:822-824(1980). | |
NP02675 |
VAPAQHLCGSHLVDALYLVCGDRGFFYNP
|
29 | Lophius americanus | Insulin | Insulin B chain | ||
NP02676 |
GIVEQCCHRPCNIFDLQNYCN
|
21 | Lophius americanus | Insulin | Insulin A chain | ||
NP02677 |
FVNQHLCGSHLVEALYLVCGERGFFYTPKT
|
30 | Macaca fascicularis | Insulin | Insulin B chain | ||
NP02678 |
GIVEQCCTSICSLYQLENYCN
|
21 | Macaca fascicularis | Insulin | Insulin A chain | ||
NP02679 |
AKWMDDVIKACGRELVRAQIAICGKSTLG
|
29 | Macaca mulatta | Insulin | Relaxin B chain (By similarity) | ||
NP02680 |
QLYMTLSNKCCHIGCTKKSLAKFC
|
24 | Macaca mulatta | Insulin | Relaxin A chain (By similarity) | ||
NP02681 |
AANQHLCGSHLVEALYLVCGERGFFYSPKA
|
30 | Meleagris gallopavo | Insulin | Insulin B chain | 5066110#Jentsch J.#Structure and increased activity of insulin from the turkey (Meleagris gallopavo).# Hoppe-Seyler's Z. Physiol. Chem. 353:980-986(1972). | |
NP02682 |
GIVEQCCHNTCSLYQLENYCN
|
21 | Meleagris gallopavo | Insulin | Insulin A chain | 5066110#Jentsch J.#Structure and increased activity of insulin from the turkey (Meleagris gallopavo).# Hoppe-Seyler's Z. Physiol. Chem. 353:980-986(1972). | |
NP02683 |
RVTKEWLDEVIHVCGREYVRAILDICAATVGLEAPPL
|
37 | Mesocricetus auratus | Insulin | Relaxin B chain (By similarity) | ||
NP02684 |
YTSIYMSHQCCFRGCSRRSLTAAC
|
24 | Mesocricetus auratus | Insulin | Relaxin A chain (By similarity) | ||
NP02685 |
FVKQHLCGPHLVEALYLVCGERGFFYTPKS
|
30 | Mus musculus | Insulin | Insulin-1 B chain | 5063718#Buenzli H.F., Glatthaar B., Kunz P., Muelhaupt E., Humbel R.E.#Amino acid sequence of the two insulins from mouse (Maus musculus).# Hoppe-Seyler's Z. Physiol. Chem. 353:451-458(1972). | |
NP02686 |
GIVDQCCTSICSLYQLENYCN
|
21 | Mus musculus | Insulin | Insulin-1 A chain | 5063718#Buenzli H.F., Glatthaar B., Kunz P., Muelhaupt E., Humbel R.E.#Amino acid sequence of the two insulins from mouse (Maus musculus).# Hoppe-Seyler's Z. Physiol. Chem. 353:451-458(1972). | |
NP02687 |
FVKQHLCGSHLVEALYLVCGERGFFYTPMS
|
30 | Mus musculus | Insulin | Insulin-2 B chain | 5063718#Buenzli H.F., Glatthaar B., Kunz P., Muelhaupt E., Humbel R.E.#Amino acid sequence of the two insulins from mouse (Maus musculus).# Hoppe-Seyler's Z. Physiol. Chem. 353:451-458(1972). | |
NP02688 |
LSETLCGSELVDTLQFVCDDRGFFFVPQHVPPRRGAHRRSRARKGIVEECCFKGCSLRLLEMYCARPSKAERDVARPRQRPHRASQHSRRGSQSRGRGRSR
|
101 | Myxine glutinosa | Insulin | Insulin-like growth factor | ||
NP02689 |
AYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSSRGIVEECCFRSCDLALLETYCATPAKSE
|
68 | Neovison vison | Insulin | Insulin-like growth factor II | ||
NP02690 |
DVSTPPTVLPDNFPRYPVGKFFQYDTWKQSAQRL
|
34 | Neovison vison | Insulin | Preptin | ||
NP02691 |
YSSQHLCGSNLVEALYMTCGRSGFYRPHD
|
29 | Octodon degus | Insulin | Insulin B chain | 2192710#Hellman U., Wernstedt C., Westermark P., O'Brien T.D., Rathbun W.B., Johnson K.H.#Amino acid sequence from degu islet amyloid-derived insulin shows unique sequence characteristics.# Biochem. Biophys. Res. Commun. 169:571-577(1990). | |
NP02692 |
GIVDQCCNNICTFNQLQNYCNVP
|
23 | Octodon degus | Insulin | Insulin A chain | 2192710#Hellman U., Wernstedt C., Westermark P., O'Brien T.D., Rathbun W.B., Johnson K.H.#Amino acid sequence from degu islet amyloid-derived insulin shows unique sequence characteristics.# Biochem. Biophys. Res. Commun. 169:571-577(1990). | |
NP02693 |
AAAQHLCGSHLVDALYLVCGEKGFFYTP
|
28 | Oncorhynchus keta | Insulin | Insulin B chain | 3314270#Rusakov Y.I., Karasev V.S., Pertseva M.N., Pankov Y.A.#Amino acid sequence of the insulin of the dog salmon Oncorhynchus keta.# Zh. Evol. Biokhim. Fiziol. 23:473-480(1987). | |
NP02694 |
GIVEQCCHKPCNIFDLQNYCN
|
21 | Oncorhynchus keta | Insulin | Insulin A chain | 3314270#Rusakov Y.I., Karasev V.S., Pertseva M.N., Pankov Y.A.#Amino acid sequence of the insulin of the dog salmon Oncorhynchus keta.# Zh. Evol. Biokhim. Fiziol. 23:473-480(1987). | |
NP02695 |
GPETLCGAELVDTLQFVCGERGFYFSKPTGYGPSSRRSHNRGIVDECCFQSCELRRLEMYCAPVKSGKAA
|
70 | Oncorhynchus kisutch | Insulin | Insulin-like growth factor I | 8243465#Moriyama S., Duguay S.J., Conlon J.M., Duan C., Dickhoff W.W., Plisetskaya E.M.#Recombinant coho salmon insulin-like growth factor I. Expression in Escherichia coli, purification and characterization.# Eur. J. Biochem. 218:205-211(1993). | |
NP02696 |
GPETLCGAELVDTLQFVCGERGFYFSKPTGYGPSSRRSHNRGIVDECCFQSCELRRLEMYCAPVKSGKAA
|
70 | Oncorhynchus mykiss | Insulin | Insulin-like growth factor I | ||
NP02697 |
EVASAETLCGGELVDALQFVCEDRGFYFSRPTSRSNSRRSQNRGIVEECCFRSCDLNLLEQYCAKPAKSE
|
70 | Oncorhynchus mykiss | Insulin | Insulin-like growth factor II | ||
NP02698 |
VGGPQHLCGSHLVDALYLVCGDRGFFYNPR
|
30 | Oreochromis niloticus | Insulin | Insulin B chain | 7656183#Nguyen T.M., Wright J.R. Jr., Nielsen P.F., Conlon J.M.#Characterization of the pancreatic hormones from the Brockmann body of the tilapia: implications for islet xenograft studies.# Comp. Biochem. Physiol. 111C:33-44(1995). | |
NP02699 |
GIVEECCHKPCTIFDLQNYCN
|
21 | Oreochromis niloticus | Insulin | Insulin A chain | 7656183#Nguyen T.M., Wright J.R. Jr., Nielsen P.F., Conlon J.M.#Characterization of the pancreatic hormones from the Brockmann body of the tilapia: implications for islet xenograft studies.# Comp. Biochem. Physiol. 111C:33-44(1995). | |
NP02700 |
FPNQHLCGSHLVEALYLVCGEKGFYYIPRM
|
30 | Ornithorhynchus anatinus | Insulin | Insulin B chain | 8868070#Nourse A., Treacy G.B., Shaw D.C., Jeffrey P.D.#Platypus insulin: indications from the amino acid sequence of significant differences in structure from porcine insulin.# Biol. Chem. Hoppe-Seyler 377:147-153(1996). | |
NP02701 |
GIVEECCKGVCSMYQLENYCN
|
21 | Ornithorhynchus anatinus | Insulin | Insulin A chain | 8868070#Nourse A., Treacy G.B., Shaw D.C., Jeffrey P.D.#Platypus insulin: indications from the amino acid sequence of significant differences in structure from porcine insulin.# Biol. Chem. Hoppe-Seyler 377:147-153(1996). | |
NP02702 |
GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKAA
|
70 | Oryctolagus cuniculus | Insulin | Insulin-like growth factor I | ||
NP02703 |
FVNQHLCGSHLVEALYLVCGERGFFYTPKS
|
30 | Oryctolagus cuniculus | Insulin | Insulin B chain | 5949593#Smith L.F.#Species variation in the amino acid sequence of insulin.# Am. J. Med. 40:662-666(1966). | |
NP02704 |
GIVEQCCTSICSLYQLENYCN
|
21 | Oryctolagus cuniculus | Insulin | Insulin A chain | 5949593#Smith L.F.#Species variation in the amino acid sequence of insulin.# Am. J. Med. 40:662-666(1966). | |
NP02705 |
RVTYEWMMENVKICRNDFVRTAIEVCGHVHLE
|
32 | Oryctolagus cuniculus | Insulin | Relaxin-like protein SQ10 B chain (By similarity) | ||
NP02706 |
QFSESLPEECCKYGCPRYYLLMYC
|
24 | Oryctolagus cuniculus | Insulin | Relaxin-like protein SQ10 A chain (By similarity) | ||
NP02707 |
GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKAAKSA
|
70 | Ovis aries | Insulin | Insulin-like growth factor I | 2537174#Francis G.L., McNeil K.A., Wallace J.C., Ballard F.J., Owens P.C.#Sheep insulin-like growth factors I and II: sequences, activities and assays.# Endocrinology 124:1173-1183(1989). | |
NP02708 |
AYRPSETLCGGELVDTLQFVCGDRGFYFSRPSSRINRRSRGIVEECCFRSCDLALLETYCAAPAKSE
|
67 | Ovis aries | Insulin | Insulin-like growth factor II | 2537174#Francis G.L., McNeil K.A., Wallace J.C., Ballard F.J., Owens P.C.#Sheep insulin-like growth factors I and II: sequences, activities and assays.# Endocrinology 124:1173-1183(1989). | |
NP02709 |
DVSASTTVLPDDFTAYPVGKFFQSDTWKQSTQRL
|
34 | Ovis aries | Insulin | Preptin | ||
NP02710 |
FVNQHLCGSHLVEALYLVCGERGFFYTPKA
|
30 | Ovis aries | Insulin | Insulin B chain | 13249948#Brown H., Sanger F., Kitai R.#The structure of pig and sheep insulins.# Biochem. J. 60:556-565(1955). | |
NP02711 |
GIVEQCCAGVCSLYQLENYCN
|
21 | Ovis aries | Insulin | Insulin A chain | 13249948#Brown H., Sanger F., Kitai R.#The structure of pig and sheep insulins.# Biochem. J. 60:556-565(1955). | |
NP02712 |
DSWMDEVIKLCGRELVRAQIAICGKSTWS
|
29 | Pan troglodytes | Insulin | Relaxin B chain (By similarity) | ||
NP02713 |
QLYSALANKCCHVGCTKRSLARFC
|
24 | Pan troglodytes | Insulin | Relaxin A chain (By similarity) | ||
NP02714 |
GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
|
70 | Panthera tigris altaica | Insulin | Insulin-like growth factor I | ||
NP02715 |
ASSQHLCGSHLVDALYMVCGEKGFFYQPKT
|
30 | Pantodon buchholzi | Insulin | Insulin B chain | ||
NP02716 |
GIVEQCCHHPCNIFDLQNYCN
|
21 | Pantodon buchholzi | Insulin | Insulin A chain | ||
NP02717 |
FVNQHLCGSHLVEALYLVCGERGFFYTPKA
|
30 | Physeter catodon | Insulin | Insulin B chain | 13373434#Harris J.I., Sanger F., Naughton M.A.#Species differences in insulin.# Arch. Biochem. Biophys. 65:427-438(1956).$13552701#Ishihara Y., Saito T., Ito Y., Fujino M.#Structure of sperm- and sei-whale insulins and their breakdown by whale pepsin.#Nature 181:1468-1469(1958). | |
NP02718 |
GIVEQCCTSICSLYQLENYCN
|
21 | Physeter catodon | Insulin | Insulin A chain | 13373434#Harris J.I., Sanger F., Naughton M.A.#Species differences in insulin.# Arch. Biochem. Biophys. 65:427-438(1956).$13552701#Ishihara Y., Saito T., Ito Y., Fujino M.#Structure of sperm- and sei-whale insulins and their breakdown by whale pepsin.#Nature 181:1468-1469(1958). | |
NP02719 |
FVNQHLCGSHLVEALYLVCGERGFFYTPKT
|
30 | Pongo pygmaeus | Insulin | Insulin B chain | ||
NP02720 |
GIVEQCCTSICSLYQLENYCN
|
21 | Pongo pygmaeus | Insulin | Insulin A chain | ||
NP02721 |
FVNQHLCGSHLVEALYLVCGERGFFYTPKF
|
30 | Psammomys obesus | Insulin | Insulin B chain | ||
NP02722 |
GIVEQCCTGICSLYQLENYCN
|
21 | Psammomys obesus | Insulin | Insulin A chain | ||
NP02723 |
FVKQHLCGPHLVEALYLVCGERGFFYTPKS
|
30 | Rattus norvegicus | Insulin | Insulin-1 B chain | 4311938#Steiner D.F., Clark J.L., Nolan C., Rubenstein A.H., Margoliash E., Aten B., Oyer P.E.#Proinsulin and the biosynthesis of insulin.# Recent Prog. Horm. Res. 25:207-282(1969). | |
NP02724 |
GIVDQCCTSICSLYQLENYCN
|
21 | Rattus norvegicus | Insulin | Insulin-1 A chain | 4311938#Steiner D.F., Clark J.L., Nolan C., Rubenstein A.H., Margoliash E., Aten B., Oyer P.E.#Proinsulin and the biosynthesis of insulin.# Recent Prog. Horm. Res. 25:207-282(1969). | |
NP02725 |
FVKQHLCGSHLVEALYLVCGERGFFYTPMS
|
30 | Rattus norvegicus | Insulin | Insulin-2 B chain | 4311938#Steiner D.F., Clark J.L., Nolan C., Rubenstein A.H., Margoliash E., Aten B., Oyer P.E.#Proinsulin and the biosynthesis of insulin.# Recent Prog. Horm. Res. 25:207-282(1969). | |
NP02726 |
FVNQHLCGSHLVEALYILVCGERGFFYTPMS
|
31 | Rodentia sp | Insulin | Insulin B chain | ||
NP02727 |
IVQQCTSGICSLYQENYCN
|
19 | Rodentia sp | Insulin | Insulin A chain | ||
NP02728 |
FVNQHLCGPHLVEALYLVCGERGFFYAPKT
|
30 | Saimiri sciureus | Insulin | Insulin B chain | 2263627#Yu J.-H., Eng J., Yalow R.S.#Isolation and amino acid sequences of squirrel monkey (Saimiri sciurea) insulin and glucagon.# Proc. Natl. Acad. Sci. U.S.A. 87:9766-9768(1990). | |
NP02729 |
GVVDQCCTSICSLYQLQNYCN
|
21 | Saimiri sciureus | Insulin | Insulin A chain | 2263627#Yu J.-H., Eng J., Yalow R.S.#Isolation and amino acid sequences of squirrel monkey (Saimiri sciurea) insulin and glucagon.# Proc. Natl. Acad. Sci. U.S.A. 87:9766-9768(1990). | |
NP02730 |
AVNQHLCGSHLVEALYLVCGERGFFYSPKA
|
30 | Selasphorus rufus | Insulin | Insulin B chain | ||
NP02731 |
GIVEQCCHNTCSLYQLENYCN
|
21 | Selasphorus rufus | Insulin | Insulin A chain | ||
NP02732 |
FVNQHLCGSHLVEALYLVCGERGFFYTPKS
|
30 | Spermophilus tridecemlineatus | Insulin | Insulin B chain | ||
NP02733 |
GIVEQCCTSICSLYQLENYCN
|
21 | Spermophilus tridecemlineatus | Insulin | Insulin A chain | ||
NP02734 |
AANQHLCGSHLVEALYLVCGERGFFYSPKA
|
30 | Struthio camelus | Insulin | Insulin B chain | 3045031#Evans T.K., Litthauer D., Oelofsen W.#Purification and primary structure of ostrich insulin.# Int. J. Pept. Protein Res. 31:454-462(1988). | |
NP02735 |
GIVEQCCHNTCSLYQLENYCN
|
21 | Struthio camelus | Insulin | Insulin A chain | 3045031#Evans T.K., Litthauer D., Oelofsen W.#Purification and primary structure of ostrich insulin.# Int. J. Pept. Protein Res. 31:454-462(1988). | |
NP02736 |
GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKAA
|
70 | Suncus murinus | Insulin | Insulin-like growth factor I | ||
NP02737 |
GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
|
70 | Sus scrofa | Insulin | Insulin-like growth factor I | ||
NP02738 |
AYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVNRRSRGIVEECCFRSCDLALLETYCATPAKSE
|
67 | Sus scrofa | Insulin | Insulin-like growth factor II | 2809477#Francis G.L., Owens P.C., McNeil K.A., Wallace J.C., Ballard F.J.#Purification, amino acid sequences and assay cross-reactivities of porcine insulin-like growth factor-I and -II.# J. Endocrinol. 122:681-687(1989). | |
NP02739 |
DVSTPPTVLPDNFPRYPVGKFFRYDTWKQSAQRL
|
34 | Sus scrofa | Insulin | Preptin | ||
NP02740 |
FVNQHLCGSHLVEALYLVCGERGFFYTPKA
|
30 | Sus scrofa | Insulin | Insulin B chain | 5657063#Chance R.E., Ellis R.M., Bromer W.W.#Porcine proinsulin: characterization and amino acid sequence.# Science 161:165-167(1968). | |
NP02741 |
GIVEQCCTSICSLYQLENYCN
|
21 | Sus scrofa | Insulin | Insulin A chain | 5657063#Chance R.E., Ellis R.M., Bromer W.W.#Porcine proinsulin: characterization and amino acid sequence.# Science 161:165-167(1968). | |
NP02742 |
RASPYGVKLCGREFIRAVIFTCGGSRW
|
27 | Sus scrofa | Insulin | Relaxin-3 B chain | 14522968#Liu C., Eriste E., Sutton S., Chen J., Roland B., Kuei C., Farmer N., Joernvall H., Sillard R., Lovenberg T.W.#Identification of relaxin-3/INSL7 as an endogenous ligand for the orphan G-protein coupled receptor GPCR135.# J. Biol. Chem. 278:50754-50764(2003). | |
NP02743 |
DVLAGLSSNCCKWGCSKSEISSLC
|
24 | Sus scrofa | Insulin | Relaxin-3 A chain | 14522968#Liu C., Eriste E., Sutton S., Chen J., Roland B., Kuei C., Farmer N., Joernvall H., Sillard R., Lovenberg T.W.#Identification of relaxin-3/INSL7 as an endogenous ligand for the orphan G-protein coupled receptor GPCR135.# J. Biol. Chem. 278:50754-50764(2003). | |
NP02744 |
QSTNDFIKACGRELVRLWVEICGSVSWGRTAL
|
32 | Sus scrofa | Insulin | Relaxin B chain | 876374#James R., Niall H., Kwok S., Bryant-Greenwood G.#Primary structure of porcine relaxin: homology with insulin and related growth factors.# Nature 267:544-546(1977).$851452#Schwabe C., McDonald J.K., Steinetz B.G.#Primary structure of the B-chain of porcine relaxin.#Biochem. Biophys. Res. Commun. 75:503-510(1977). | |
NP02745 |
RMTLSEKCCQVGCIRKDIARLC
|
22 | Sus scrofa | Insulin | Relaxin A chain | 876374#James R., Niall H., Kwok S., Bryant-Greenwood G.#Primary structure of porcine relaxin: homology with insulin and related growth factors.# Nature 267:544-546(1977).$938497#Schwabe C., McDonald J.K., Steinetz B.G.#Primary structure of the A chain of porcine relaxin.#Biochem. Biophys. Res. Commun. 70:397-405(1976). | |
NP02746 |
AANQHLCGSHLVEALYLVCGERGFFYSPKA
|
30 | Trachemys dorbigni | Insulin | Insulin B chain | 1808015#Cascone O., Turyn D., Dellacha J.M., Machado V.L.A., Marques M., Vita N., Cassan C., Ferrara P., Guillemot J.-C.#Isolation, purification and primary structure of insulin from the turtle Chrysemys dorbigni.# Gen. Comp. Endocrinol. 84:355-359(1991). | |
NP02747 |
GIVEQCCHNTCSLYQLENYCN
|
21 | Trachemys dorbigni | Insulin | Insulin A chain | 1808015#Cascone O., Turyn D., Dellacha J.M., Machado V.L.A., Marques M., Vita N., Cassan C., Ferrara P., Guillemot J.-C.#Isolation, purification and primary structure of insulin from the turtle Chrysemys dorbigni.# Gen. Comp. Endocrinol. 84:355-359(1991). | |
NP02748 |
AANQHLCGSHLVEALYLVCGERGFFYSPKA
|
30 | Trachemys scripta | Insulin | Insulin B chain | 1974347#Conlon J.M., Hicks J.W.#Isolation and structural characterization of insulin, glucagon and somatostatin from the turtle, Pseudemys scripta.# Peptides 11:461-466(1990). | |
NP02749 |
GIVEQCCHNTCSLYQLENYCN
|
21 | Trachemys scripta | Insulin | Insulin A chain | 1974347#Conlon J.M., Hicks J.W.#Isolation and structural characterization of insulin, glucagon and somatostatin from the turtle, Pseudemys scripta.# Peptides 11:461-466(1990). | |
NP02750 |
QAVLPPQHLCGAHLVDALYLVCGERGFFYTP
|
31 | Verasper moseri | Insulin | Insulin B chain | ||
NP02751 |
GIVEQCCHKPCNIFDLQNYCN
|
21 | Verasper moseri | Insulin | Insulin A chain | ||
NP02752 |
GPETLCGAELVDTLQFVCGDRGFYFSKPTGYGSNNRRSHHRGIVDECCFQSCDFRRLEMYCAPAKQAKSA
|
70 | Xenopus laevis | Insulin | Insulin-like growth factor I-A | ||
NP02753 |
YRATETLCGGELVDTLQFVCGDRGFYFSTNNGRSNRRPNRGIVDVCCFKSCDLELLETYCAKPTKNE
|
67 | Xenopus laevis | Insulin | Insulin-like growth factor II-A | ||
NP02754 |
YRPTETLCGGELVDTLQFVCGDRGFYFSTNNGRSNRRSNRGIVEECCFRSCDLELLETYCAKPSKNE
|
67 | Xenopus laevis | Insulin | Insulin-like growth factor II-B | ||
NP02755 |
RCLRPRSKELLCGSELVDILQFICGPTGFYVSKGASFRNRNRPGIVEECCFCGCSVAILESYCAAPVTNFTG
|
72 | Xenopus laevis | Insulin | Insulin-like growth factor III | ||
NP02756 |
LVNQHLCGSHLVEALYLVCGDRGFFYYPKV
|
30 | Xenopus laevis | Insulin | Insulin-1 B chain | 2661211#Shuldiner A.R., Bennett C., Robinson E.A., Roth J.#Isolation and characterization of two different insulins from an amphibian, Xenopus laevis.# Endocrinology 125:469-477(1989). | |
NP02757 |
GIVEQCCHSTCSLFQLESYCN
|
21 | Xenopus laevis | Insulin | Insulin-1 A chain | 2661211#Shuldiner A.R., Bennett C., Robinson E.A., Roth J.#Isolation and characterization of two different insulins from an amphibian, Xenopus laevis.# Endocrinology 125:469-477(1989). | |
NP02758 |
LANQHLCGSHLVEALYLVCGDRGFFYYPKI
|
30 | Xenopus laevis | Insulin | Insulin-2 B chain | 2661211#Shuldiner A.R., Bennett C., Robinson E.A., Roth J.#Isolation and characterization of two different insulins from an amphibian, Xenopus laevis.# Endocrinology 125:469-477(1989). | |
NP02759 |
GIVEQCCHSTCSLFQLENYCN
|
21 | Xenopus laevis | Insulin | Insulin-2 A chain | 2661211#Shuldiner A.R., Bennett C., Robinson E.A., Roth J.#Isolation and characterization of two different insulins from an amphibian, Xenopus laevis.# Endocrinology 125:469-477(1989). | |
NP02760 |
GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
|
70 | Bos taurus | Insulin | Insulin-like growth factor I | 3941093# Honegger A., Humbel R.E.; # "Insulin-like growth factors I and II in fetal and adult bovine serum. Purification, primary structures, and immunological cross- reactivities."; # J. Biol. Chem. 261:569-575(1986).$3390164#Francis G.L., Upton F.M., Ballard F.J., McNeil K.A., Wallace J.C.; #"Insulin-like growth factors 1 and 2 in bovine colostrum. Sequences and biological activities compared with those of a potent truncated form."; #Biochem. J. 251:95-103(1988). | |
NP02761 |
AYRPSETLCGGELVDTLQFVCGDRGFYFSRPSSRINRRSRGIVEECCFRSCDLALLETYCATPAKSE
|
67 | Bos taurus | Insulin | Insulin-like growth factor II | 3941093# Honegger A., Humbel R.E.; # "Insulin-like growth factors I and II in fetal and adult bovine serum. Purification, primary structures, and immunological cross- reactivities."; # J. Biol. Chem. 261:569-575(1986). | |
NP02762 |
DVSASTTVLPDDVTAYPVGKFFQYDIWKQSTQRL
|
34 | Bos taurus | Insulin | Preptin | ||
NP02763 |
GIVEQCCASVCSLYQLENYCN
|
21 | Bos taurus | Insulin | Insulin A chain | 13032079#Sanger F., Thompson E.O.P.; #"The amino-acid sequence in the glycyl chain of insulin. 2. The investigation of peptides from enzymic hydrolysates."; #Biochem. J. 53:366-374(1953).$13249947#Ryle A.P., Sanger F., Smith L.F., Kitai R.; #"The disulphide bonds of insulin."; #Biochem. J. 60:541-556(1955). | |
NP02764 |
FVNQHLCGSHLVEALYLVCGERGFFYTPKA
|
30 | Bos taurus | Insulin | Insulin B chain | 14886311#Sanger F., Tuppy H.; #"The amino-acid sequence in the phenylalanyl chain of insulin. 2. The investigation of peptides from enzymic hydrolysates."; #Biochem. J. 49:481-490(1951).$13249947#Ryle A.P., Sanger F., Smith L.F., Kitai R.; #"The disulphide bonds of insulin."; #Biochem. J. 60:541-556(1955). | |
NP02765 |
GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
|
70 | Homo sapiens | Insulin | Insulin-like growth factor I | 632300# Rinderknecht E., Humbel R.E.; # "The amino acid sequence of human insulin-like growth factor I and its structural homology with proinsulin."; # J. Biol. Chem. 253:2769-2776(1978). | |
NP02766 |
AYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRSCDLALLETYCATPAKSE
|
67 | Homo sapiens | Insulin | Insulin-like growth factor II | 658418# Rinderknecht E., Humbel R.E.; # "Primary structure of human insulin-like growth factor II."; # FEBS Lett. 89:283-286(1978).$12586351#Nedelkov D., Nelson R.W., Kiernan U.A., Niederkofler E.E., Tubbs K.A.;#"Detection of bound and free IGF-1 and IGF-2 in human plasma via biomolecular interaction analysis mass spectrometry.";#FEBS Lett. 536:130-134(2003).$15359740#Nelson R.W., Nedelkov D., Tubbs K.A., Kiernan U.A.;#"Quantitative mass spectrometric immunoassay of insulin like growth factor 1.";#J. Proteome Res. 3:851-855(2004). | |
NP02767 |
YRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRSCDLALLETYCATPAKSE
|
66 | Homo sapiens | Insulin | Insulin-like growth factor II Ala-25 Del | 12586351#Nedelkov D., Nelson R.W., Kiernan U.A., Niederkofler E.E., Tubbs K.A.;#"Detection of bound and free IGF-1 and IGF-2 in human plasma via biomolecular interaction analysis mass spectrometry.";#FEBS Lett. 536:130-134(2003).$15359740#Nelson R.W., Nedelkov D., Tubbs K.A., Kiernan U.A.;#"Quantitative mass spectrometric immunoassay of insulin like growth factor 1.";#J. Proteome Res. 3:851-855(2004). | |
NP02768 |
DVSTPPTVLPDNFPRYPVGKFFQYDTWKQSTQRL
|
34 | Homo sapiens | Insulin | Preptin | ||
NP02769 |
GIVEQCCTSICSLYQLENYCN
|
21 | Homo sapiens | Insulin | Insulin A chain | 14426955# Nicol D.S.H.W., Smith L.F.; # "Amino-acid sequence of human insulin."; # Nature 187:483-485(1960). | |
NP02770 |
FVNQHLCGSHLVEALYLVCGERGFFYTPKT
|
30 | Homo sapiens | Insulin | Insulin B chain | 14426955# Nicol D.S.H.W., Smith L.F.; # "Amino-acid sequence of human insulin."; # Nature 187:483-485(1960). | |
NP02771 |
PYVALFEKCCLIGCTKRSLAKYC
|
23 | Homo sapiens | Insulin | Relaxin A chain (By similarity) | ||
NP02772 |
VAAKWKDDVIKLCGRELVRAQIAICGMSTWS
|
31 | Homo sapiens | Insulin | Relaxin B chain (By similarity) | ||
NP02773 |
QLYSALANKCCHVGCTKRSLARFC
|
24 | Homo sapiens | Insulin | Relaxin A chain | 2076464#Winslow J.W., Griffin P.R., Rinderknecht E., Vandlen R.L.; #"Structural characterization by mass spectrometry of native and recombinant human relaxin."; #Biomed. Environ. Mass Spectrom. 19:655-664(1990). | |
NP02774 |
DSWMEEVIKLCGRELVRAQIAICGMSTWS
|
29 | Homo sapiens | Insulin | Relaxin B chain | 2076464#Winslow J.W., Griffin P.R., Rinderknecht E., Vandlen R.L.; #"Structural characterization by mass spectrometry of native and recombinant human relaxin."; #Biomed. Environ. Mass Spectrom. 19:655-664(1990). | |
NP02775 |
DVLAGLSSSCCKWGCSKSEISSLC
|
24 | Homo sapiens | Insulin | Relaxin-3 A chain (By similarity) | ||
NP02776 |
RAAPYGVRLCGREFIRAVIFTCGGSRW
|
27 | Homo sapiens | Insulin | Relaxin-3 B chain (By similarity) | ||
NP02777 |
GPETLCGAELVDALQFVCGPRGFYFNKPTGYGSSIRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPTKAA
|
70 | Mus musculus | Insulin | Insulin-like growth factor I | ||
NP02778 |
AYGPGETLCGGELVDTLQFVCSDRGFYFSRPSSRANRRSRGIVEECCFRSCDLALLETYCATPAKSE
|
67 | Mus musculus | Insulin | Insulin-like growth factor II | ||
NP02779 |
DVSTSQAVLPDDFPRYPVGKFFQYDTWRQSAGRL
|
34 | Mus musculus | Insulin | Preptin | 11716772# Buchanan C.M., Phillips A.R., Cooper G.J.; # "Preptin derived from proinsulin-like growth factor II (proIGF-II) is secreted from pancreatic islet beta-cells and enhances insulin secretion."; # Biochem. J. 360:431-439(2001). | |
NP02780 |
ESGGLMSQQCCHVGCSRRSIAKLYC
|
25 | Mus musculus | Insulin | Relaxin A chain (By similarity) | ||
NP02781 |
RVSEEWMDGFIRMCGREYARELIKICGASVGRLAL
|
35 | Mus musculus | Insulin | Relaxin B chain (By similarity) | ||
NP02782 |
DVLAGLSSSCCEWGCSKSQISSLC
|
24 | Mus musculus | Insulin | Relaxin-3 A chain (By similarity) | ||
NP02783 |
RPAPYGVKLCGREFIRAVIFTCGGSRW
|
27 | Mus musculus | Insulin | Relaxin-3 B chain (By similarity) | ||
NP02784 |
GIVEQCCTSICSLYQLENYCN
|
21 | Pan troglodytes | Insulin | Insulin A chain | ||
NP02785 |
FVNQHLCGSHLVEALYLVCGERGFFYTPKT
|
30 | Pan troglodytes | Insulin | Insulin B chain | ||
NP02786 |
QPYVALFEKCCLIGCTKRSLANYC
|
24 | Pan troglodytes | Insulin | Relaxin A chain (By similarity) | ||
NP02787 |
DSWMDEVIKLCGRELVRAQIAICGMSTWS
|
29 | Pan troglodytes | Insulin | Relaxin B chain (By similarity) | ||
NP02788 |
DVLAGLSSSCCKWGCSKSEISSLC
|
24 | Pan troglodytes | Insulin | Relaxin-3 A chain (By similarity) | ||
NP02789 |
RAAPYGVRLCGREFIRAVIFTCGGSRW
|
27 | Pan troglodytes | Insulin | Relaxin-3 B chain (By similarity) | ||
NP02790 |
GPETLCGAELVDALQFVCGPRGFYFNKPTGYGSSIRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPTKSA
|
70 | Rattus norvegicus | Insulin | Insulin-like growth factor I | 2538424# Tamura K., Kobayashi M., Ishii Y., Tamura T., Hashimoto K., Nakamura S., Niwa M., Zapf J.; # "Primary structure of rat insulin-like growth factor-I and its biological activities."; # J. Biol. Chem. 264:5616-5621(1989). | |
NP02791 |
AYRPSETLCGGELVDTLQFVCSDRGFYFSRPSSRANRRSRGIVEECCFRSCDLALLETYCATPAKSE
|
67 | Rattus norvegicus | Insulin | Insulin-like growth factor II | 7016879# Marquardt H., Todaro G.J., Henderson L.E., Oroszlan S.; # "Purification and primary structure of a polypeptide with multiplication-stimulating activity from rat liver cell cultures. Homology with human insulin-like growth factor II."; # J. Biol. Chem. 256:6859-6865(1981). | |
NP02792 |
DVSTSQAVLPDDFPRYPVGKFFKFDTWRQSAGRL
|
34 | Rattus norvegicus | Insulin | Preptin | ||
NP02793 |
QSGALLSEQCCHIGCTRRSIAKLC
|
24 | Rattus norvegicus | Insulin | Relaxin A chain | 7004862# John M.J., Borjesson B.W., Walsh J.R., Niall H.D.; # "Limited sequence homology between porcine and rat relaxins: implications for physiological studies."; # Endocrinology 108:726-729(1981). | |
NP02794 |
RVSEEWMDQVIQVCGRGYARAWIEVCGASVGRLAL
|
35 | Rattus norvegicus | Insulin | Relaxin B chain | 7004862# John M.J., Borjesson B.W., Walsh J.R., Niall H.D.; # "Limited sequence homology between porcine and rat relaxins: implications for physiological studies."; # Endocrinology 108:726-729(1981). | |
NP02795 |
DVLAGLSSSCCEWGCSKSQISSLC
|
24 | Rattus norvegicus | Insulin | Relaxin-3 A chain (By similarity) | ||
NP02796 |
RPAPYGVKLCGREFIRAVIFTCGGSRW
|
27 | Rattus norvegicus | Insulin | Relaxin-3 B chain (By similarity) |