| NPID | NP02695 |
| Name | Insulin-like growth factor I |
| Organism | Oncorhynchus kisutch |
| NCBI Taxa ID | 8019 |
| Tissue Specificity | All the isoforms are expressed in embryos, juvenile and adult liver, muscle and brain. At least one isoform is expressed in heart, kidney, testes, ovary, adipose tissue and spleen of juvenile salmon. |
| Family | Insulin |
| UniProt ID | IGF1_ONCKI |
| Length | 70 |
| Modification | |
| Gene Ontology | |
| Sequence | GPETLCGAELVDTLQFVCGERGFYFSKPTGYGPSSRRSHNRGIVDECCFQSCELRRLEMYCAPVKSGKAA |
| Properties | View |
| Structure | |
| Reference |