Browse by organism
Total number of results for Apis mellifera are 82
Download as  Fasta  All
NPID Sequence Length Organism Family Name PMID Peptide_REF
NP00282
AYTYVSEYKRLPVYNFGI
 18 Apis mellifera Allatostatin Allatostatin A 19576913#Boerjan B, Cardoen D, Bogaerts A, Landuyt B, Schoofs L, Verleyen P#Mass spectrometric profiling of (neuro)-peptides in the worker honeybee, Apis mellifera#Neuropharmacology 2010 Jan;58(1):248-58
NP00504
AYTYVSEY
 8 Apis mellifera Allatostatin Allatostatin-1 17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J., Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L., Robinson G.E., Sweedler J.V.; #From the genome to the proteome: uncovering peptides in the Apis brain.; #Science 314:647-649(2006).
NP00505
LPVYNFGI
 8 Apis mellifera Allatostatin Allatostatin-2a 17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J., Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L., Robinson G.E., Sweedler J.V.; #From the genome to the proteome: uncovering peptides in the Apis brain.; #Science 314:647-649(2006).
NP00506
LPVYNF
 6 Apis mellifera Allatostatin Allatostatin-2b 17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J., Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L., Robinson G.E., Sweedler J.V.; #From the genome to the proteome: uncovering peptides in the Apis brain.; #Science 314:647-649(2006).
NP00507
GRDYSFGL
 8 Apis mellifera Allatostatin Allatostatin-3 17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J., Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L., Robinson G.E., Sweedler J.V.; #From the genome to the proteome: uncovering peptides in the Apis brain.; #Science 314:647-649(2006).
NP00508
RQYSFGL
 7 Apis mellifera Allatostatin Allatostatin-4 17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J., Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L., Robinson G.E., Sweedler J.V.; #From the genome to the proteome: uncovering peptides in the Apis brain.; #Science 314:647-649(2006).
NP00509
NDNADYPLRLNLDYLPVDNPAFHSQENTDDFLEE
 34 Apis mellifera Allatostatin Allatostatin-5 17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J., Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L., Robinson G.E., Sweedler J.V.; #From the genome to the proteome: uncovering peptides in the Apis brain.; #Science 314:647-649(2006).
NP00510
GRQPYSFGL
 9 Apis mellifera Allatostatin Allatostatin-6 17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J., Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L., Robinson G.E., Sweedler J.V.; #From the genome to the proteome: uncovering peptides in the Apis brain.; #Science 314:647-649(2006).
NP00511
AVHYSGGQPLGSKRPNDMLSQRYHFGL
 27 Apis mellifera Allatostatin Allatostatin-7a 17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J., Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L., Robinson G.E., Sweedler J.V.; #From the genome to the proteome: uncovering peptides in the Apis brain.; #Science 314:647-649(2006).
NP00512
AVHYSGGQPLGS
 12 Apis mellifera Allatostatin Allatostatin-7b 17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J., Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L., Robinson G.E., Sweedler J.V.; #From the genome to the proteome: uncovering peptides in the Apis brain.; #Science 314:647-649(2006).
NP00513
PNDMLSQRYHFGL
 13 Apis mellifera Allatostatin Allatostatin-7c 17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J., Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L., Robinson G.E., Sweedler J.V.; #From the genome to the proteome: uncovering peptides in the Apis brain.; #Science 314:647-649(2006).
NP00590
SYWKQCAFNAVSCF
 14 Apis mellifera Allatostatin Allatostatin C 19576913#Boerjan B, Cardoen D, Bogaerts A, Landuyt B, Schoofs L, Verleyen P#Mass spectrometric profiling of (neuro)-peptides in the worker honeybee, Apis mellifera#Neuropharmacology 2010 Jan;58(1):248-58 $17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J.,Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L.,Robinson G.E., Sweedler J.V.#From the genome to the proteome: uncovering peptides in the Apis brain.#Science 314:647-649(2006).
NP00591
LRNQLDIGDL
 10 Apis mellifera Allatostatin LRNQLDIGDLQ–allatostatinC 19576913#Boerjan B, Cardoen D, Bogaerts A, Landuyt B, Schoofs L, Verleyen P#Mass spectrometric profiling of (neuro)-peptides in the worker honeybee, Apis mellifera#Neuropharmacology 2010 Jan;58(1):248-58 $17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J.,Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L.,Robinson G.E., Sweedler J.V.#From the genome to the proteome: uncovering peptides in the Apis brain.#Science 314:647-649(2006).
NP00592
LRNQLDIGDLQ
 11 Apis mellifera Allatostatin LRNQLDIGDLQ–allatostatinC 19576913#Boerjan B, Cardoen D, Bogaerts A, Landuyt B, Schoofs L, Verleyen P#Mass spectrometric profiling of (neuro)-peptides in the worker honeybee, Apis mellifera#Neuropharmacology 2010 Jan;58(1):248-58 $17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J.,Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L.,Robinson G.E., Sweedler J.V.#From the genome to the proteome: uncovering peptides in the Apis brain.#Science 314:647-649(2006).
NP00733
NSELINSLLGLPKNMNNA
 18 Apis mellifera Arthropod PDH Pigment dispersing factor 19576913#Boerjan B, Cardoen D, Bogaerts A, Landuyt B, Schoofs L, Verleyen P#Mass spectrometric profiling of (neuro)-peptides in the worker honeybee, Apis mellifera#Neuropharmacology 2010 Jan;58(1):248-58
NP00864
GLDLGLSRGFSGSQAAKHLMGLAAANYAGGP
 31 Apis mellifera Calcitonin-like peptide Calcitonin-like diuretic hormone 19576913#Boerjan B, Cardoen D, Bogaerts A, Landuyt B, Schoofs L, Verleyen P#Mass spectrometric profiling of (neuro)-peptides in the worker honeybee, Apis mellifera#Neuropharmacology 2010 Jan;58(1):248-58 $17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J.,Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L.,Robinson G.E., Sweedler J.V.#From the genome to the proteome: uncovering peptides in the Apis brain.#Science 314:647-649(2006).
NP01026
SFSENMINDHRQPAPTNNNY
 20 Apis mellifera Corazonin Corazonin 19576913#Boerjan B, Cardoen D, Bogaerts A, Landuyt B, Schoofs L, Verleyen P#Mass spectrometric profiling of (neuro)-peptides in the worker honeybee, Apis mellifera#Neuropharmacology 2010 Jan;58(1):248-58
NP01045
QTFTYSHGWTN
 11 Apis mellifera Corazonin Corazonin 16406615# Verleyen P., Baggerman G., Mertens I., Vandersmissen T., Huybrechts J., Van Lommel A., De Loof A., Schoofs L.; #Cloning and characterization of a third isoform of corazonin in the honey bee Apis mellifera.; # Peptides 27:493-499(2006).$17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J., Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L., Robinson G.E., Sweedler J.V.; #From the genome to the proteome: uncovering peptides in the Apis brain.; #Science 314:647-649(2006).
NP01046
STSLEELANRNAIQSDNVFANCELQKLRLLLQGNINNQLFQTPCELLNFP
 50 Apis mellifera Corazonin Corazonin precursor-related peptide
NP01047
QTFTYSHGWTNGKRSTSLEELANRNAIQSDNVFANCELQKLRLLLQGNINNQLFQTPCELLNFPKRSFSENMINDHRQPAPTNNNY
 86 Apis mellifera Corazonin Pro-corazonin (Potential)
NP01263
AYRKPPFNGSIF
 12 Apis mellifera FMRFamide related peptide SIFamide 19576913#Boerjan B, Cardoen D, Bogaerts A, Landuyt B, Schoofs L, Verleyen P#Mass spectrometric profiling of (neuro)-peptides in the worker honeybee, Apis mellifera#Neuropharmacology 2010 Jan;58(1):248-58
NP01264
RKPPFNGSIF
 10 Apis mellifera FMRFamide related peptide SIFamide 19576913#Boerjan B, Cardoen D, Bogaerts A, Landuyt B, Schoofs L, Verleyen P#Mass spectrometric profiling of (neuro)-peptides in the worker honeybee, Apis mellifera#Neuropharmacology 2010 Jan;58(1):248-58
NP01265
YRKPPFNGSIF
 11 Apis mellifera FMRFamide related peptide SIFamide 19576913#Boerjan B, Cardoen D, Bogaerts A, Landuyt B, Schoofs L, Verleyen P#Mass spectrometric profiling of (neuro)-peptides in the worker honeybee, Apis mellifera#Neuropharmacology 2010 Jan;58(1):248-58
NP01266
AGFKNLNREQ
 10 Apis mellifera FMRFamide related peptide TWKSPDIVIRFa–FMRFa-like 19576913#Boerjan B, Cardoen D, Bogaerts A, Landuyt B, Schoofs L, Verleyen P#Mass spectrometric profiling of (neuro)-peptides in the worker honeybee, Apis mellifera#Neuropharmacology 2010 Jan;58(1):248-58
NP01267
SVLTTLKTDGGLRIFKDAPNEF
 22 Apis mellifera FMRFamide related peptide TWKSPDIVIRFa–FMRFa-like 19576913#Boerjan B, Cardoen D, Bogaerts A, Landuyt B, Schoofs L, Verleyen P#Mass spectrometric profiling of (neuro)-peptides in the worker honeybee, Apis mellifera#Neuropharmacology 2010 Jan;58(1):248-58
NP01268
TWKSPDIVIRF
 11 Apis mellifera FMRFamide related peptide TWKSPDIVIRFa–FMRFa-like 19576913#Boerjan B, Cardoen D, Bogaerts A, Landuyt B, Schoofs L, Verleyen P#Mass spectrometric profiling of (neuro)-peptides in the worker honeybee, Apis mellifera#Neuropharmacology 2010 Jan;58(1):248-58
NP02062
QQFDDYGHLRF
 11 Apis mellifera Gastrin/cholecystokinin Sulfakinin 19576913#Boerjan B, Cardoen D, Bogaerts A, Landuyt B, Schoofs L, Verleyen P#Mass spectrometric profiling of (neuro)-peptides in the worker honeybee, Apis mellifera#Neuropharmacology 2010 Jan;58(1):248-58
NP03072
QDVDHVFLRF
 10 Apis mellifera Myosuppressin Myosuppressin 17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J., Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L., Robinson G.E., Sweedler J.V.; #From the genome to the proteome: uncovering peptides in the Apis brain.; #Science 314:647-649(2006).
NP03185
GNNRPVYIPQPRPPHP
 16 Apis mellifera NA Apidaecin-1 19576913#Boerjan B, Cardoen D, Bogaerts A, Landuyt B, Schoofs L, Verleyen P#Mass spectrometric profiling of (neuro)-peptides in the worker honeybee, Apis mellifera#Neuropharmacology 2010 Jan;58(1):248-58
NP03186
PVYIPQPRPP
 10 Apis mellifera NA Apidaecin-1 19576913#Boerjan B, Cardoen D, Bogaerts A, Landuyt B, Schoofs L, Verleyen P#Mass spectrometric profiling of (neuro)-peptides in the worker honeybee, Apis mellifera#Neuropharmacology 2010 Jan;58(1):248-58
NP03187
GIFLPGSVILRALSRQ
 16 Apis mellifera NA Neuropeptide like precursor 1 19576913#Boerjan B, Cardoen D, Bogaerts A, Landuyt B, Schoofs L, Verleyen P#Mass spectrometric profiling of (neuro)-peptides in the worker honeybee, Apis mellifera#Neuropharmacology 2010 Jan;58(1):248-58
NP03188
NIASLMRDYDQSRENRVPFP
 20 Apis mellifera NA Neuropeptide like precursor 1 19576913#Boerjan B, Cardoen D, Bogaerts A, Landuyt B, Schoofs L, Verleyen P#Mass spectrometric profiling of (neuro)-peptides in the worker honeybee, Apis mellifera#Neuropharmacology 2010 Jan;58(1):248-58
NP03189
NVASLARTYTLPQNA
 15 Apis mellifera NA Neuropeptide like precursor 1 19576913#Boerjan B, Cardoen D, Bogaerts A, Landuyt B, Schoofs L, Verleyen P#Mass spectrometric profiling of (neuro)-peptides in the worker honeybee, Apis mellifera#Neuropharmacology 2010 Jan;58(1):248-58
NP03190
NVGSVAREHGLPY
 13 Apis mellifera NA Neuropeptide like precursor 1 19576913#Boerjan B, Cardoen D, Bogaerts A, Landuyt B, Schoofs L, Verleyen P#Mass spectrometric profiling of (neuro)-peptides in the worker honeybee, Apis mellifera#Neuropharmacology 2010 Jan;58(1):248-58
NP03191
NVGTLARDFALPP
 13 Apis mellifera NA Neuropeptide like precursor 1 19576913#Boerjan B, Cardoen D, Bogaerts A, Landuyt B, Schoofs L, Verleyen P#Mass spectrometric profiling of (neuro)-peptides in the worker honeybee, Apis mellifera#Neuropharmacology 2010 Jan;58(1):248-58
NP03192
SIATLAKNDDLPISLHDRMAENEDDEE
 27 Apis mellifera NA Neuropeptide like precursor 1 19576913#Boerjan B, Cardoen D, Bogaerts A, Landuyt B, Schoofs L, Verleyen P#Mass spectrometric profiling of (neuro)-peptides in the worker honeybee, Apis mellifera#Neuropharmacology 2010 Jan;58(1):248-58
NP03193
SVSSLARTGDLPVREQ
 16 Apis mellifera NA Neuropeptide like precursor 1 19576913#Boerjan B, Cardoen D, Bogaerts A, Landuyt B, Schoofs L, Verleyen P#Mass spectrometric profiling of (neuro)-peptides in the worker honeybee, Apis mellifera#Neuropharmacology 2010 Jan;58(1):248-58
NP03194
YVASLARTGDLPIRGQ
 16 Apis mellifera NA Neuropeptide like precursor 1 19576913#Boerjan B, Cardoen D, Bogaerts A, Landuyt B, Schoofs L, Verleyen P#Mass spectrometric profiling of (neuro)-peptides in the worker honeybee, Apis mellifera#Neuropharmacology 2010 Jan;58(1):248-58
NP03593
GNNRPVYIPQPRPPHPRL
 18 Apis mellifera NA Apidaecin-1 19576913#Boerjan B, Cardoen D, Bogaerts A, Landuyt B, Schoofs L, Verleyen P#Mass spectrometric profiling of (neuro)-peptides in the worker honeybee, Apis mellifera#Neuropharmacology 2010 Jan;58(1):248-58 $2676519#Casteels P., Ampe C., Jacobs F., Vaeck M., Tempst P.#Apidaecins: antibacterial peptides from honeybees.#EMBO J. 8:2387-2391(1989).
NP03594
MVPVPVHHMADELLRNGPDTVI
 22 Apis mellifera NA Brain peptide MVPVPVHHMADELLRNGPDTVI 19576913#Boerjan B, Cardoen D, Bogaerts A, Landuyt B, Schoofs L, Verleyen P#Mass spectrometric profiling of (neuro)-peptides in the worker honeybee, Apis mellifera#Neuropharmacology 2010 Jan;58(1):248-58 $17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J.,Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L.,Robinson G.E., Sweedler J.V.#From the genome to the proteome: uncovering peptides in the Apis brain.#Science 314:647-649(2006).
NP03595
GYPYQHRLVY
 10 Apis mellifera NA Brain peptide GYPYQHRLVY 19576913#Boerjan B, Cardoen D, Bogaerts A, Landuyt B, Schoofs L, Verleyen P#Mass spectrometric profiling of (neuro)-peptides in the worker honeybee, Apis mellifera#Neuropharmacology 2010 Jan;58(1):248-58 $17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J.,Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L.,Robinson G.E., Sweedler J.V.#From the genome to the proteome: uncovering peptides in the Apis brain.#Science 314:647-649(2006).
NP03596
NVPIYQEPRF
 10 Apis mellifera NA Brain peptide NVPIYQEPRF 19576913#Boerjan B, Cardoen D, Bogaerts A, Landuyt B, Schoofs L, Verleyen P#Mass spectrometric profiling of (neuro)-peptides in the worker honeybee, Apis mellifera#Neuropharmacology 2010 Jan;58(1):248-58 $17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J.,Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L.,Robinson G.E., Sweedler J.V.#From the genome to the proteome: uncovering peptides in the Apis brain.#Science 314:647-649(2006).
NP03597
SQAYDPYSNAAQFQLSSQSRGYPYQHRLVY
 30 Apis mellifera NA Brain peptide SQAYDPYSNAAQFQLSSQSRGYPYQHRLVY 19576913#Boerjan B, Cardoen D, Bogaerts A, Landuyt B, Schoofs L, Verleyen P#Mass spectrometric profiling of (neuro)-peptides in the worker honeybee, Apis mellifera#Neuropharmacology 2010 Jan;58(1):248-58 $17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J.,Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L.,Robinson G.E., Sweedler J.V.#From the genome to the proteome: uncovering peptides in the Apis brain.#Science 314:647-649(2006).
NP03598
ITGQGNRIF
 9 Apis mellifera NA Brain peptide ITGQGNRIF 19576913#Boerjan B, Cardoen D, Bogaerts A, Landuyt B, Schoofs L, Verleyen P#Mass spectrometric profiling of (neuro)-peptides in the worker honeybee, Apis mellifera#Neuropharmacology 2010 Jan;58(1):248-58 $17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J.,Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L.,Robinson G.E., Sweedler J.V.#From the genome to the proteome: uncovering peptides in the Apis brain.#Science 314:647-649(2006).
NP03599
DLSRFYGHFN
 10 Apis mellifera NA Brain peptide DLSRFYGHFNT 19576913#Boerjan B, Cardoen D, Bogaerts A, Landuyt B, Schoofs L, Verleyen P#Mass spectrometric profiling of (neuro)-peptides in the worker honeybee, Apis mellifera#Neuropharmacology 2010 Jan;58(1):248-58 $17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J.,Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L.,Robinson G.E., Sweedler J.V.#From the genome to the proteome: uncovering peptides in the Apis brain.#Science 314:647-649(2006).
NP03600
IDLSRFYGHF
 10 Apis mellifera NA Brain peptide IDLSRFYGHF 19576913#Boerjan B, Cardoen D, Bogaerts A, Landuyt B, Schoofs L, Verleyen P#Mass spectrometric profiling of (neuro)-peptides in the worker honeybee, Apis mellifera#Neuropharmacology 2010 Jan;58(1):248-58 $17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J.,Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L.,Robinson G.E., Sweedler J.V.#From the genome to the proteome: uncovering peptides in the Apis brain.#Science 314:647-649(2006).
NP03601
IDLSRFYGHFN
 11 Apis mellifera NA Brain peptide IDLSRFYGHFN 19576913#Boerjan B, Cardoen D, Bogaerts A, Landuyt B, Schoofs L, Verleyen P#Mass spectrometric profiling of (neuro)-peptides in the worker honeybee, Apis mellifera#Neuropharmacology 2010 Jan;58(1):248-58 $17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J.,Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L.,Robinson G.E., Sweedler J.V.#From the genome to the proteome: uncovering peptides in the Apis brain.#Science 314:647-649(2006).
NP03602
IDLSRFYGHFNT
 12 Apis mellifera NA Brain peptide IDLSRFYGHFNT 19576913#Boerjan B, Cardoen D, Bogaerts A, Landuyt B, Schoofs L, Verleyen P#Mass spectrometric profiling of (neuro)-peptides in the worker honeybee, Apis mellifera#Neuropharmacology 2010 Jan;58(1):248-58 $17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J.,Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L.,Robinson G.E., Sweedler J.V.#From the genome to the proteome: uncovering peptides in the Apis brain.#Science 314:647-649(2006).
NP03805
SDPHLSILSKPMSAIPSYKFDD
 22 Apis mellifera NPY Short neuropeptide F 19576913#Boerjan B, Cardoen D, Bogaerts A, Landuyt B, Schoofs L, Verleyen P#Mass spectrometric profiling of (neuro)-peptides in the worker honeybee, Apis mellifera#Neuropharmacology 2010 Jan;58(1):248-58
NP03806
SPSLRLRF
 8 Apis mellifera NPY Short neuropeptide F 19576913#Boerjan B, Cardoen D, Bogaerts A, Landuyt B, Schoofs L, Verleyen P#Mass spectrometric profiling of (neuro)-peptides in the worker honeybee, Apis mellifera#Neuropharmacology 2010 Jan;58(1):248-58
NP03970
GRNDLNFIRY
 10 Apis mellifera NPY TWKSPDIVIRFa–FMRFa-like 19576913#Boerjan B, Cardoen D, Bogaerts A, Landuyt B, Schoofs L, Verleyen P#Mass spectrometric profiling of (neuro)-peptides in the worker honeybee, Apis mellifera#Neuropharmacology 2010 Jan;58(1):248-58
NP04378
NLDEIDRVGWSGFV
 14 Apis mellifera Orcokinin Brain peptide NLDEIDRVGWSGFV 17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J., Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L., Robinson G.E., Sweedler J.V.; #From the genome to the proteome: uncovering peptides in the Apis brain.; #Science 314:647-649(2006).
NP04379
LTNYLATTGHGTNTGGPVLT
 20 Apis mellifera Orcokinin Orcokinin 17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J., Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L., Robinson G.E., Sweedler J.V.; #From the genome to the proteome: uncovering peptides in the Apis brain.; #Science 314:647-649(2006).
NP04380
NIDEIDRTAFDNFF
 14 Apis mellifera Orcokinin Orcokinin-like peptide-1 17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J., Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L., Robinson G.E., Sweedler J.V.; #From the genome to the proteome: uncovering peptides in the Apis brain.; #Science 314:647-649(2006).
NP04381
IDEIDRTAFDNFF
 13 Apis mellifera Orcokinin Orcokinin-like peptide-2 17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J., Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L., Robinson G.E., Sweedler J.V.; #From the genome to the proteome: uncovering peptides in the Apis brain.; #Science 314:647-649(2006).
NP04382
EIDRTAFDNFF
 11 Apis mellifera Orcokinin Orcokinin-like peptide-3 17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J., Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L., Robinson G.E., Sweedler J.V.; #From the genome to the proteome: uncovering peptides in the Apis brain.; #Science 314:647-649(2006).
NP04434
AFGLLTYPRI
 10 Apis mellifera Periviscerokinin Periviscerokinin-like (CAPA) 19576913#Boerjan B, Cardoen D, Bogaerts A, Landuyt B, Schoofs L, Verleyen P#Mass spectrometric profiling of (neuro)-peptides in the worker honeybee, Apis mellifera#Neuropharmacology 2010 Jan;58(1):248-58
NP04435
EKLKPNMRRAFGLLTYPRI
 19 Apis mellifera Periviscerokinin Periviscerokinin-like (CAPA) 19576913#Boerjan B, Cardoen D, Bogaerts A, Landuyt B, Schoofs L, Verleyen P#Mass spectrometric profiling of (neuro)-peptides in the worker honeybee, Apis mellifera#Neuropharmacology 2010 Jan;58(1):248-58
NP04959
RVPWTPSPRL
 10 Apis mellifera Pyrokinin Pheromone biosynthesis activating neuropeptide 19576913#Boerjan B, Cardoen D, Bogaerts A, Landuyt B, Schoofs L, Verleyen P#Mass spectrometric profiling of (neuro)-peptides in the worker honeybee, Apis mellifera#Neuropharmacology 2010 Jan;58(1):248-58
NP05016
IYLPLFASRL
 10 Apis mellifera Pyrokinin IYLPLFASRL-amide 17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J., Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L., Robinson G.E., Sweedler J.V.; #From the genome to the proteome: uncovering peptides in the Apis brain.; #Science 314:647-649(2006).
NP05017
QITQFTPRL
 9 Apis mellifera Pyrokinin QITQFTPRL-amide 17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J., Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L., Robinson G.E., Sweedler J.V.; #From the genome to the proteome: uncovering peptides in the Apis brain.; #Science 314:647-649(2006).
NP05018
TSQDITSGMWFGPRL
 15 Apis mellifera Pyrokinin TSQDITSGMWFGPRL-amide 17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J., Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L., Robinson G.E., Sweedler J.V.; #From the genome to the proteome: uncovering peptides in the Apis brain.; #Science 314:647-649(2006).
NP05019
VPWTPSPRL
 9 Apis mellifera Pyrokinin VPWTPSPRL-amide 17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J., Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L., Robinson G.E., Sweedler J.V.; #From the genome to the proteome: uncovering peptides in the Apis brain.; #Science 314:647-649(2006).
NP05548
APMGFYGTRG
 10 Apis mellifera Tachykinin Tachykinin 19576913#Boerjan B, Cardoen D, Bogaerts A, Landuyt B, Schoofs L, Verleyen P#Mass spectrometric profiling of (neuro)-peptides in the worker honeybee, Apis mellifera#Neuropharmacology 2010 Jan;58(1):248-58
NP05609
ALMGFQGVR
 9 Apis mellifera Tachykinin ALMGFQGVR-amide 12752663# Takeuchi H., Yasuda A., Yasuda-Kamatani Y., Kubo T., Nakajima T.; #Identification of a tachykinin-related neuropeptide from the honeybee brain using direct MALDI-TOF MS and its gene expression in worker, queen and drone heads.; # Insect Mol. Biol. 12:291-298(2003).$17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J., Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L., Robinson G.E., Sweedler J.V.; #From the genome to the proteome: uncovering peptides in the Apis brain.; #Science 314:647-649(2006).
NP05610
APMGFQGMR
 9 Apis mellifera Tachykinin APMGFQGMR-amide 1 12752663# Takeuchi H., Yasuda A., Yasuda-Kamatani Y., Kubo T., Nakajima T.; #Identification of a tachykinin-related neuropeptide from the honeybee brain using direct MALDI-TOF MS and its gene expression in worker, queen and drone heads.; # Insect Mol. Biol. 12:291-298(2003).$17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J., Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L., Robinson G.E., Sweedler J.V.; #From the genome to the proteome: uncovering peptides in the Apis brain.; #Science 314:647-649(2006).
NP05611
APMGFYGTR
 9 Apis mellifera Tachykinin APMGFYGTR-amide 12752663# Takeuchi H., Yasuda A., Yasuda-Kamatani Y., Kubo T., Nakajima T.; #Identification of a tachykinin-related neuropeptide from the honeybee brain using direct MALDI-TOF MS and its gene expression in worker, queen and drone heads.; # Insect Mol. Biol. 12:291-298(2003).$17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J., Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L., Robinson G.E., Sweedler J.V.; #From the genome to the proteome: uncovering peptides in the Apis brain.; #Science 314:647-649(2006).
NP05612
APTGHQEMQ
 9 Apis mellifera Tachykinin APTGHQEMQ-amide 12752663#Takeuchi H., Yasuda A., Yasuda-Kamatani Y., Kubo T., Nakajima T.; #Identification of a tachykinin-related neuropeptide from the honeybee brain using direct MALDI-TOF MS and its gene expression in worker, queen and drone heads.; #Insect Mol. Biol. 12:291-298(2003).
NP05613
ARMGFHGMR
 9 Apis mellifera Tachykinin ARMGFHGMR-amide 17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J., Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L., Robinson G.E., Sweedler J.V.; #From the genome to the proteome: uncovering peptides in the Apis brain.; #Science 314:647-649(2006).
NP05614
APMGFYGT
 8 Apis mellifera Tachykinin Brain peptide APMGFYGT 17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J., Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L., Robinson G.E., Sweedler J.V.; #From the genome to the proteome: uncovering peptides in the Apis brain.; #Science 314:647-649(2006).
NP05615
ASFDDEYY
 8 Apis mellifera Tachykinin Brain peptide ASFDDEYY 17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J., Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L., Robinson G.E., Sweedler J.V.; #From the genome to the proteome: uncovering peptides in the Apis brain.; #Science 314:647-649(2006).
NP05616
EILDEI
 6 Apis mellifera Tachykinin Brain peptide EILDEI 17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J., Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L., Robinson G.E., Sweedler J.V.; #From the genome to the proteome: uncovering peptides in the Apis brain.; #Science 314:647-649(2006).
NP05617
GVMDFQIGLQ
 10 Apis mellifera Tachykinin Brain peptide GVMDFQIGLQ 17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J., Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L., Robinson G.E., Sweedler J.V.; #From the genome to the proteome: uncovering peptides in the Apis brain.; #Science 314:647-649(2006).
NP05618
IILDALEELD
 10 Apis mellifera Tachykinin Brain peptide IILDALEELD 17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J., Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L., Robinson G.E., Sweedler J.V.; #From the genome to the proteome: uncovering peptides in the Apis brain.; #Science 314:647-649(2006).
NP05619
ILDALEELD
 9 Apis mellifera Tachykinin Brain peptide ILDALEELD 17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J., Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L., Robinson G.E., Sweedler J.V.; #From the genome to the proteome: uncovering peptides in the Apis brain.; #Science 314:647-649(2006).
NP05620
NSIINDVKNELFPEDIN
 17 Apis mellifera Tachykinin Brain peptide NSIINDVKNELFPEDIN 17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J., Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L., Robinson G.E., Sweedler J.V.; #From the genome to the proteome: uncovering peptides in the Apis brain.; #Science 314:647-649(2006).
NP05621
SLEEILDEI
 9 Apis mellifera Tachykinin Brain peptide SLEEILDEI 17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J., Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L., Robinson G.E., Sweedler J.V.; #From the genome to the proteome: uncovering peptides in the Apis brain.; #Science 314:647-649(2006).
NP05622
SLEEILDEIK
 10 Apis mellifera Tachykinin Brain peptide SLEEILDEIK 17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J., Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L., Robinson G.E., Sweedler J.V.; #From the genome to the proteome: uncovering peptides in the Apis brain.; #Science 314:647-649(2006).
NP05623
VLSMDGYQNILDKKDELLGEWE
 22 Apis mellifera Tachykinin Brain peptide VLSMDGYQNILDKKDELLGEWE 17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J., Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L., Robinson G.E., Sweedler J.V.; #From the genome to the proteome: uncovering peptides in the Apis brain.; #Science 314:647-649(2006).
NP05624
NPRWEFRGKFVGVR
 14 Apis mellifera Tachykinin NPRWEFRGKFVGVR-amide 17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J., Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L., Robinson G.E., Sweedler J.V.; #From the genome to the proteome: uncovering peptides in the Apis brain.; #Science 314:647-649(2006).
NP05625
SPFRYLGAR
 9 Apis mellifera Tachykinin SPFRYLGAR-amide 17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J., Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L., Robinson G.E., Sweedler J.V.; #From the genome to the proteome: uncovering peptides in the Apis brain.; #Science 314:647-649(2006).
NP05626
TTRFQDSRSKDVYLIDYPEDY
 21 Apis mellifera Tachykinin TTRFQDSRSKDVYLIDYPEDY-amide 17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J., Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L., Robinson G.E., Sweedler J.V.; #From the genome to the proteome: uncovering peptides in the Apis brain.; #Science 314:647-649(2006).