Total number of results for Apis mellifera are 82
Download
as Fasta All
NPID | Sequence | Length | Organism | Family | Name | PMID | Peptide_REF |
---|---|---|---|---|---|---|---|
NP00282 |
AYTYVSEYKRLPVYNFGI
|
18 | Apis mellifera | Allatostatin | Allatostatin A | 19576913#Boerjan B, Cardoen D, Bogaerts A, Landuyt B, Schoofs L, Verleyen P#Mass spectrometric profiling of (neuro)-peptides in the worker honeybee, Apis mellifera#Neuropharmacology 2010 Jan;58(1):248-58 | |
NP00504 |
AYTYVSEY
|
8 | Apis mellifera | Allatostatin | Allatostatin-1 | 17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J., Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L., Robinson G.E., Sweedler J.V.; #From the genome to the proteome: uncovering peptides in the Apis brain.; #Science 314:647-649(2006). | |
NP00505 |
LPVYNFGI
|
8 | Apis mellifera | Allatostatin | Allatostatin-2a | 17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J., Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L., Robinson G.E., Sweedler J.V.; #From the genome to the proteome: uncovering peptides in the Apis brain.; #Science 314:647-649(2006). | |
NP00506 |
LPVYNF
|
6 | Apis mellifera | Allatostatin | Allatostatin-2b | 17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J., Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L., Robinson G.E., Sweedler J.V.; #From the genome to the proteome: uncovering peptides in the Apis brain.; #Science 314:647-649(2006). | |
NP00507 |
GRDYSFGL
|
8 | Apis mellifera | Allatostatin | Allatostatin-3 | 17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J., Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L., Robinson G.E., Sweedler J.V.; #From the genome to the proteome: uncovering peptides in the Apis brain.; #Science 314:647-649(2006). | |
NP00508 |
RQYSFGL
|
7 | Apis mellifera | Allatostatin | Allatostatin-4 | 17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J., Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L., Robinson G.E., Sweedler J.V.; #From the genome to the proteome: uncovering peptides in the Apis brain.; #Science 314:647-649(2006). | |
NP00509 |
NDNADYPLRLNLDYLPVDNPAFHSQENTDDFLEE
|
34 | Apis mellifera | Allatostatin | Allatostatin-5 | 17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J., Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L., Robinson G.E., Sweedler J.V.; #From the genome to the proteome: uncovering peptides in the Apis brain.; #Science 314:647-649(2006). | |
NP00510 |
GRQPYSFGL
|
9 | Apis mellifera | Allatostatin | Allatostatin-6 | 17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J., Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L., Robinson G.E., Sweedler J.V.; #From the genome to the proteome: uncovering peptides in the Apis brain.; #Science 314:647-649(2006). | |
NP00511 |
AVHYSGGQPLGSKRPNDMLSQRYHFGL
|
27 | Apis mellifera | Allatostatin | Allatostatin-7a | 17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J., Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L., Robinson G.E., Sweedler J.V.; #From the genome to the proteome: uncovering peptides in the Apis brain.; #Science 314:647-649(2006). | |
NP00512 |
AVHYSGGQPLGS
|
12 | Apis mellifera | Allatostatin | Allatostatin-7b | 17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J., Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L., Robinson G.E., Sweedler J.V.; #From the genome to the proteome: uncovering peptides in the Apis brain.; #Science 314:647-649(2006). | |
NP00513 |
PNDMLSQRYHFGL
|
13 | Apis mellifera | Allatostatin | Allatostatin-7c | 17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J., Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L., Robinson G.E., Sweedler J.V.; #From the genome to the proteome: uncovering peptides in the Apis brain.; #Science 314:647-649(2006). | |
NP00590 |
SYWKQCAFNAVSCF
|
14 | Apis mellifera | Allatostatin | Allatostatin C | 19576913#Boerjan B, Cardoen D, Bogaerts A, Landuyt B, Schoofs L, Verleyen P#Mass spectrometric profiling of (neuro)-peptides in the worker honeybee, Apis mellifera#Neuropharmacology 2010 Jan;58(1):248-58 $17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J.,Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L.,Robinson G.E., Sweedler J.V.#From the genome to the proteome: uncovering peptides in the Apis brain.#Science 314:647-649(2006). | |
NP00591 |
LRNQLDIGDL
|
10 | Apis mellifera | Allatostatin | LRNQLDIGDLQ–allatostatinC | 19576913#Boerjan B, Cardoen D, Bogaerts A, Landuyt B, Schoofs L, Verleyen P#Mass spectrometric profiling of (neuro)-peptides in the worker honeybee, Apis mellifera#Neuropharmacology 2010 Jan;58(1):248-58 $17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J.,Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L.,Robinson G.E., Sweedler J.V.#From the genome to the proteome: uncovering peptides in the Apis brain.#Science 314:647-649(2006). | |
NP00592 |
LRNQLDIGDLQ
|
11 | Apis mellifera | Allatostatin | LRNQLDIGDLQ–allatostatinC | 19576913#Boerjan B, Cardoen D, Bogaerts A, Landuyt B, Schoofs L, Verleyen P#Mass spectrometric profiling of (neuro)-peptides in the worker honeybee, Apis mellifera#Neuropharmacology 2010 Jan;58(1):248-58 $17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J.,Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L.,Robinson G.E., Sweedler J.V.#From the genome to the proteome: uncovering peptides in the Apis brain.#Science 314:647-649(2006). | |
NP00733 |
NSELINSLLGLPKNMNNA
|
18 | Apis mellifera | Arthropod PDH | Pigment dispersing factor | 19576913#Boerjan B, Cardoen D, Bogaerts A, Landuyt B, Schoofs L, Verleyen P#Mass spectrometric profiling of (neuro)-peptides in the worker honeybee, Apis mellifera#Neuropharmacology 2010 Jan;58(1):248-58 | |
NP00864 |
GLDLGLSRGFSGSQAAKHLMGLAAANYAGGP
|
31 | Apis mellifera | Calcitonin-like peptide | Calcitonin-like diuretic hormone | 19576913#Boerjan B, Cardoen D, Bogaerts A, Landuyt B, Schoofs L, Verleyen P#Mass spectrometric profiling of (neuro)-peptides in the worker honeybee, Apis mellifera#Neuropharmacology 2010 Jan;58(1):248-58 $17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J.,Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L.,Robinson G.E., Sweedler J.V.#From the genome to the proteome: uncovering peptides in the Apis brain.#Science 314:647-649(2006). | |
NP01026 |
SFSENMINDHRQPAPTNNNY
|
20 | Apis mellifera | Corazonin | Corazonin | 19576913#Boerjan B, Cardoen D, Bogaerts A, Landuyt B, Schoofs L, Verleyen P#Mass spectrometric profiling of (neuro)-peptides in the worker honeybee, Apis mellifera#Neuropharmacology 2010 Jan;58(1):248-58 | |
NP01045 |
QTFTYSHGWTN
|
11 | Apis mellifera | Corazonin | Corazonin | 16406615# Verleyen P., Baggerman G., Mertens I., Vandersmissen T., Huybrechts J., Van Lommel A., De Loof A., Schoofs L.; #Cloning and characterization of a third isoform of corazonin in the honey bee Apis mellifera.; # Peptides 27:493-499(2006).$17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J., Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L., Robinson G.E., Sweedler J.V.; #From the genome to the proteome: uncovering peptides in the Apis brain.; #Science 314:647-649(2006). | |
NP01046 |
STSLEELANRNAIQSDNVFANCELQKLRLLLQGNINNQLFQTPCELLNFP
|
50 | Apis mellifera | Corazonin | Corazonin precursor-related peptide | ||
NP01047 |
QTFTYSHGWTNGKRSTSLEELANRNAIQSDNVFANCELQKLRLLLQGNINNQLFQTPCELLNFPKRSFSENMINDHRQPAPTNNNY
|
86 | Apis mellifera | Corazonin | Pro-corazonin (Potential) | ||
NP01263 |
AYRKPPFNGSIF
|
12 | Apis mellifera | FMRFamide related peptide | SIFamide | 19576913#Boerjan B, Cardoen D, Bogaerts A, Landuyt B, Schoofs L, Verleyen P#Mass spectrometric profiling of (neuro)-peptides in the worker honeybee, Apis mellifera#Neuropharmacology 2010 Jan;58(1):248-58 | |
NP01264 |
RKPPFNGSIF
|
10 | Apis mellifera | FMRFamide related peptide | SIFamide | 19576913#Boerjan B, Cardoen D, Bogaerts A, Landuyt B, Schoofs L, Verleyen P#Mass spectrometric profiling of (neuro)-peptides in the worker honeybee, Apis mellifera#Neuropharmacology 2010 Jan;58(1):248-58 | |
NP01265 |
YRKPPFNGSIF
|
11 | Apis mellifera | FMRFamide related peptide | SIFamide | 19576913#Boerjan B, Cardoen D, Bogaerts A, Landuyt B, Schoofs L, Verleyen P#Mass spectrometric profiling of (neuro)-peptides in the worker honeybee, Apis mellifera#Neuropharmacology 2010 Jan;58(1):248-58 | |
NP01266 |
AGFKNLNREQ
|
10 | Apis mellifera | FMRFamide related peptide | TWKSPDIVIRFa–FMRFa-like | 19576913#Boerjan B, Cardoen D, Bogaerts A, Landuyt B, Schoofs L, Verleyen P#Mass spectrometric profiling of (neuro)-peptides in the worker honeybee, Apis mellifera#Neuropharmacology 2010 Jan;58(1):248-58 | |
NP01267 |
SVLTTLKTDGGLRIFKDAPNEF
|
22 | Apis mellifera | FMRFamide related peptide | TWKSPDIVIRFa–FMRFa-like | 19576913#Boerjan B, Cardoen D, Bogaerts A, Landuyt B, Schoofs L, Verleyen P#Mass spectrometric profiling of (neuro)-peptides in the worker honeybee, Apis mellifera#Neuropharmacology 2010 Jan;58(1):248-58 | |
NP01268 |
TWKSPDIVIRF
|
11 | Apis mellifera | FMRFamide related peptide | TWKSPDIVIRFa–FMRFa-like | 19576913#Boerjan B, Cardoen D, Bogaerts A, Landuyt B, Schoofs L, Verleyen P#Mass spectrometric profiling of (neuro)-peptides in the worker honeybee, Apis mellifera#Neuropharmacology 2010 Jan;58(1):248-58 | |
NP02062 |
QQFDDYGHLRF
|
11 | Apis mellifera | Gastrin/cholecystokinin | Sulfakinin | 19576913#Boerjan B, Cardoen D, Bogaerts A, Landuyt B, Schoofs L, Verleyen P#Mass spectrometric profiling of (neuro)-peptides in the worker honeybee, Apis mellifera#Neuropharmacology 2010 Jan;58(1):248-58 | |
NP03072 |
QDVDHVFLRF
|
10 | Apis mellifera | Myosuppressin | Myosuppressin | 17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J., Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L., Robinson G.E., Sweedler J.V.; #From the genome to the proteome: uncovering peptides in the Apis brain.; #Science 314:647-649(2006). | |
NP03185 |
GNNRPVYIPQPRPPHP
|
16 | Apis mellifera | NA | Apidaecin-1 | 19576913#Boerjan B, Cardoen D, Bogaerts A, Landuyt B, Schoofs L, Verleyen P#Mass spectrometric profiling of (neuro)-peptides in the worker honeybee, Apis mellifera#Neuropharmacology 2010 Jan;58(1):248-58 | |
NP03186 |
PVYIPQPRPP
|
10 | Apis mellifera | NA | Apidaecin-1 | 19576913#Boerjan B, Cardoen D, Bogaerts A, Landuyt B, Schoofs L, Verleyen P#Mass spectrometric profiling of (neuro)-peptides in the worker honeybee, Apis mellifera#Neuropharmacology 2010 Jan;58(1):248-58 | |
NP03187 |
GIFLPGSVILRALSRQ
|
16 | Apis mellifera | NA | Neuropeptide like precursor 1 | 19576913#Boerjan B, Cardoen D, Bogaerts A, Landuyt B, Schoofs L, Verleyen P#Mass spectrometric profiling of (neuro)-peptides in the worker honeybee, Apis mellifera#Neuropharmacology 2010 Jan;58(1):248-58 | |
NP03188 |
NIASLMRDYDQSRENRVPFP
|
20 | Apis mellifera | NA | Neuropeptide like precursor 1 | 19576913#Boerjan B, Cardoen D, Bogaerts A, Landuyt B, Schoofs L, Verleyen P#Mass spectrometric profiling of (neuro)-peptides in the worker honeybee, Apis mellifera#Neuropharmacology 2010 Jan;58(1):248-58 | |
NP03189 |
NVASLARTYTLPQNA
|
15 | Apis mellifera | NA | Neuropeptide like precursor 1 | 19576913#Boerjan B, Cardoen D, Bogaerts A, Landuyt B, Schoofs L, Verleyen P#Mass spectrometric profiling of (neuro)-peptides in the worker honeybee, Apis mellifera#Neuropharmacology 2010 Jan;58(1):248-58 | |
NP03190 |
NVGSVAREHGLPY
|
13 | Apis mellifera | NA | Neuropeptide like precursor 1 | 19576913#Boerjan B, Cardoen D, Bogaerts A, Landuyt B, Schoofs L, Verleyen P#Mass spectrometric profiling of (neuro)-peptides in the worker honeybee, Apis mellifera#Neuropharmacology 2010 Jan;58(1):248-58 | |
NP03191 |
NVGTLARDFALPP
|
13 | Apis mellifera | NA | Neuropeptide like precursor 1 | 19576913#Boerjan B, Cardoen D, Bogaerts A, Landuyt B, Schoofs L, Verleyen P#Mass spectrometric profiling of (neuro)-peptides in the worker honeybee, Apis mellifera#Neuropharmacology 2010 Jan;58(1):248-58 | |
NP03192 |
SIATLAKNDDLPISLHDRMAENEDDEE
|
27 | Apis mellifera | NA | Neuropeptide like precursor 1 | 19576913#Boerjan B, Cardoen D, Bogaerts A, Landuyt B, Schoofs L, Verleyen P#Mass spectrometric profiling of (neuro)-peptides in the worker honeybee, Apis mellifera#Neuropharmacology 2010 Jan;58(1):248-58 | |
NP03193 |
SVSSLARTGDLPVREQ
|
16 | Apis mellifera | NA | Neuropeptide like precursor 1 | 19576913#Boerjan B, Cardoen D, Bogaerts A, Landuyt B, Schoofs L, Verleyen P#Mass spectrometric profiling of (neuro)-peptides in the worker honeybee, Apis mellifera#Neuropharmacology 2010 Jan;58(1):248-58 | |
NP03194 |
YVASLARTGDLPIRGQ
|
16 | Apis mellifera | NA | Neuropeptide like precursor 1 | 19576913#Boerjan B, Cardoen D, Bogaerts A, Landuyt B, Schoofs L, Verleyen P#Mass spectrometric profiling of (neuro)-peptides in the worker honeybee, Apis mellifera#Neuropharmacology 2010 Jan;58(1):248-58 | |
NP03593 |
GNNRPVYIPQPRPPHPRL
|
18 | Apis mellifera | NA | Apidaecin-1 | 19576913#Boerjan B, Cardoen D, Bogaerts A, Landuyt B, Schoofs L, Verleyen P#Mass spectrometric profiling of (neuro)-peptides in the worker honeybee, Apis mellifera#Neuropharmacology 2010 Jan;58(1):248-58 $2676519#Casteels P., Ampe C., Jacobs F., Vaeck M., Tempst P.#Apidaecins: antibacterial peptides from honeybees.#EMBO J. 8:2387-2391(1989). | |
NP03594 |
MVPVPVHHMADELLRNGPDTVI
|
22 | Apis mellifera | NA | Brain peptide MVPVPVHHMADELLRNGPDTVI | 19576913#Boerjan B, Cardoen D, Bogaerts A, Landuyt B, Schoofs L, Verleyen P#Mass spectrometric profiling of (neuro)-peptides in the worker honeybee, Apis mellifera#Neuropharmacology 2010 Jan;58(1):248-58 $17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J.,Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L.,Robinson G.E., Sweedler J.V.#From the genome to the proteome: uncovering peptides in the Apis brain.#Science 314:647-649(2006). | |
NP03595 |
GYPYQHRLVY
|
10 | Apis mellifera | NA | Brain peptide GYPYQHRLVY | 19576913#Boerjan B, Cardoen D, Bogaerts A, Landuyt B, Schoofs L, Verleyen P#Mass spectrometric profiling of (neuro)-peptides in the worker honeybee, Apis mellifera#Neuropharmacology 2010 Jan;58(1):248-58 $17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J.,Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L.,Robinson G.E., Sweedler J.V.#From the genome to the proteome: uncovering peptides in the Apis brain.#Science 314:647-649(2006). | |
NP03596 |
NVPIYQEPRF
|
10 | Apis mellifera | NA | Brain peptide NVPIYQEPRF | 19576913#Boerjan B, Cardoen D, Bogaerts A, Landuyt B, Schoofs L, Verleyen P#Mass spectrometric profiling of (neuro)-peptides in the worker honeybee, Apis mellifera#Neuropharmacology 2010 Jan;58(1):248-58 $17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J.,Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L.,Robinson G.E., Sweedler J.V.#From the genome to the proteome: uncovering peptides in the Apis brain.#Science 314:647-649(2006). | |
NP03597 |
SQAYDPYSNAAQFQLSSQSRGYPYQHRLVY
|
30 | Apis mellifera | NA | Brain peptide SQAYDPYSNAAQFQLSSQSRGYPYQHRLVY | 19576913#Boerjan B, Cardoen D, Bogaerts A, Landuyt B, Schoofs L, Verleyen P#Mass spectrometric profiling of (neuro)-peptides in the worker honeybee, Apis mellifera#Neuropharmacology 2010 Jan;58(1):248-58 $17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J.,Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L.,Robinson G.E., Sweedler J.V.#From the genome to the proteome: uncovering peptides in the Apis brain.#Science 314:647-649(2006). | |
NP03598 |
ITGQGNRIF
|
9 | Apis mellifera | NA | Brain peptide ITGQGNRIF | 19576913#Boerjan B, Cardoen D, Bogaerts A, Landuyt B, Schoofs L, Verleyen P#Mass spectrometric profiling of (neuro)-peptides in the worker honeybee, Apis mellifera#Neuropharmacology 2010 Jan;58(1):248-58 $17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J.,Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L.,Robinson G.E., Sweedler J.V.#From the genome to the proteome: uncovering peptides in the Apis brain.#Science 314:647-649(2006). | |
NP03599 |
DLSRFYGHFN
|
10 | Apis mellifera | NA | Brain peptide DLSRFYGHFNT | 19576913#Boerjan B, Cardoen D, Bogaerts A, Landuyt B, Schoofs L, Verleyen P#Mass spectrometric profiling of (neuro)-peptides in the worker honeybee, Apis mellifera#Neuropharmacology 2010 Jan;58(1):248-58 $17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J.,Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L.,Robinson G.E., Sweedler J.V.#From the genome to the proteome: uncovering peptides in the Apis brain.#Science 314:647-649(2006). | |
NP03600 |
IDLSRFYGHF
|
10 | Apis mellifera | NA | Brain peptide IDLSRFYGHF | 19576913#Boerjan B, Cardoen D, Bogaerts A, Landuyt B, Schoofs L, Verleyen P#Mass spectrometric profiling of (neuro)-peptides in the worker honeybee, Apis mellifera#Neuropharmacology 2010 Jan;58(1):248-58 $17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J.,Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L.,Robinson G.E., Sweedler J.V.#From the genome to the proteome: uncovering peptides in the Apis brain.#Science 314:647-649(2006). | |
NP03601 |
IDLSRFYGHFN
|
11 | Apis mellifera | NA | Brain peptide IDLSRFYGHFN | 19576913#Boerjan B, Cardoen D, Bogaerts A, Landuyt B, Schoofs L, Verleyen P#Mass spectrometric profiling of (neuro)-peptides in the worker honeybee, Apis mellifera#Neuropharmacology 2010 Jan;58(1):248-58 $17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J.,Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L.,Robinson G.E., Sweedler J.V.#From the genome to the proteome: uncovering peptides in the Apis brain.#Science 314:647-649(2006). | |
NP03602 |
IDLSRFYGHFNT
|
12 | Apis mellifera | NA | Brain peptide IDLSRFYGHFNT | 19576913#Boerjan B, Cardoen D, Bogaerts A, Landuyt B, Schoofs L, Verleyen P#Mass spectrometric profiling of (neuro)-peptides in the worker honeybee, Apis mellifera#Neuropharmacology 2010 Jan;58(1):248-58 $17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J.,Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L.,Robinson G.E., Sweedler J.V.#From the genome to the proteome: uncovering peptides in the Apis brain.#Science 314:647-649(2006). | |
NP03805 |
SDPHLSILSKPMSAIPSYKFDD
|
22 | Apis mellifera | NPY | Short neuropeptide F | 19576913#Boerjan B, Cardoen D, Bogaerts A, Landuyt B, Schoofs L, Verleyen P#Mass spectrometric profiling of (neuro)-peptides in the worker honeybee, Apis mellifera#Neuropharmacology 2010 Jan;58(1):248-58 | |
NP03806 |
SPSLRLRF
|
8 | Apis mellifera | NPY | Short neuropeptide F | 19576913#Boerjan B, Cardoen D, Bogaerts A, Landuyt B, Schoofs L, Verleyen P#Mass spectrometric profiling of (neuro)-peptides in the worker honeybee, Apis mellifera#Neuropharmacology 2010 Jan;58(1):248-58 | |
NP03970 |
GRNDLNFIRY
|
10 | Apis mellifera | NPY | TWKSPDIVIRFa–FMRFa-like | 19576913#Boerjan B, Cardoen D, Bogaerts A, Landuyt B, Schoofs L, Verleyen P#Mass spectrometric profiling of (neuro)-peptides in the worker honeybee, Apis mellifera#Neuropharmacology 2010 Jan;58(1):248-58 | |
NP04378 |
NLDEIDRVGWSGFV
|
14 | Apis mellifera | Orcokinin | Brain peptide NLDEIDRVGWSGFV | 17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J., Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L., Robinson G.E., Sweedler J.V.; #From the genome to the proteome: uncovering peptides in the Apis brain.; #Science 314:647-649(2006). | |
NP04379 |
LTNYLATTGHGTNTGGPVLT
|
20 | Apis mellifera | Orcokinin | Orcokinin | 17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J., Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L., Robinson G.E., Sweedler J.V.; #From the genome to the proteome: uncovering peptides in the Apis brain.; #Science 314:647-649(2006). | |
NP04380 |
NIDEIDRTAFDNFF
|
14 | Apis mellifera | Orcokinin | Orcokinin-like peptide-1 | 17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J., Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L., Robinson G.E., Sweedler J.V.; #From the genome to the proteome: uncovering peptides in the Apis brain.; #Science 314:647-649(2006). | |
NP04381 |
IDEIDRTAFDNFF
|
13 | Apis mellifera | Orcokinin | Orcokinin-like peptide-2 | 17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J., Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L., Robinson G.E., Sweedler J.V.; #From the genome to the proteome: uncovering peptides in the Apis brain.; #Science 314:647-649(2006). | |
NP04382 |
EIDRTAFDNFF
|
11 | Apis mellifera | Orcokinin | Orcokinin-like peptide-3 | 17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J., Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L., Robinson G.E., Sweedler J.V.; #From the genome to the proteome: uncovering peptides in the Apis brain.; #Science 314:647-649(2006). | |
NP04434 |
AFGLLTYPRI
|
10 | Apis mellifera | Periviscerokinin | Periviscerokinin-like (CAPA) | 19576913#Boerjan B, Cardoen D, Bogaerts A, Landuyt B, Schoofs L, Verleyen P#Mass spectrometric profiling of (neuro)-peptides in the worker honeybee, Apis mellifera#Neuropharmacology 2010 Jan;58(1):248-58 | |
NP04435 |
EKLKPNMRRAFGLLTYPRI
|
19 | Apis mellifera | Periviscerokinin | Periviscerokinin-like (CAPA) | 19576913#Boerjan B, Cardoen D, Bogaerts A, Landuyt B, Schoofs L, Verleyen P#Mass spectrometric profiling of (neuro)-peptides in the worker honeybee, Apis mellifera#Neuropharmacology 2010 Jan;58(1):248-58 | |
NP04959 |
RVPWTPSPRL
|
10 | Apis mellifera | Pyrokinin | Pheromone biosynthesis activating neuropeptide | 19576913#Boerjan B, Cardoen D, Bogaerts A, Landuyt B, Schoofs L, Verleyen P#Mass spectrometric profiling of (neuro)-peptides in the worker honeybee, Apis mellifera#Neuropharmacology 2010 Jan;58(1):248-58 | |
NP05016 |
IYLPLFASRL
|
10 | Apis mellifera | Pyrokinin | IYLPLFASRL-amide | 17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J., Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L., Robinson G.E., Sweedler J.V.; #From the genome to the proteome: uncovering peptides in the Apis brain.; #Science 314:647-649(2006). | |
NP05017 |
QITQFTPRL
|
9 | Apis mellifera | Pyrokinin | QITQFTPRL-amide | 17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J., Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L., Robinson G.E., Sweedler J.V.; #From the genome to the proteome: uncovering peptides in the Apis brain.; #Science 314:647-649(2006). | |
NP05018 |
TSQDITSGMWFGPRL
|
15 | Apis mellifera | Pyrokinin | TSQDITSGMWFGPRL-amide | 17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J., Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L., Robinson G.E., Sweedler J.V.; #From the genome to the proteome: uncovering peptides in the Apis brain.; #Science 314:647-649(2006). | |
NP05019 |
VPWTPSPRL
|
9 | Apis mellifera | Pyrokinin | VPWTPSPRL-amide | 17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J., Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L., Robinson G.E., Sweedler J.V.; #From the genome to the proteome: uncovering peptides in the Apis brain.; #Science 314:647-649(2006). | |
NP05548 |
APMGFYGTRG
|
10 | Apis mellifera | Tachykinin | Tachykinin | 19576913#Boerjan B, Cardoen D, Bogaerts A, Landuyt B, Schoofs L, Verleyen P#Mass spectrometric profiling of (neuro)-peptides in the worker honeybee, Apis mellifera#Neuropharmacology 2010 Jan;58(1):248-58 | |
NP05609 |
ALMGFQGVR
|
9 | Apis mellifera | Tachykinin | ALMGFQGVR-amide | 12752663# Takeuchi H., Yasuda A., Yasuda-Kamatani Y., Kubo T., Nakajima T.; #Identification of a tachykinin-related neuropeptide from the honeybee brain using direct MALDI-TOF MS and its gene expression in worker, queen and drone heads.; # Insect Mol. Biol. 12:291-298(2003).$17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J., Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L., Robinson G.E., Sweedler J.V.; #From the genome to the proteome: uncovering peptides in the Apis brain.; #Science 314:647-649(2006). | |
NP05610 |
APMGFQGMR
|
9 | Apis mellifera | Tachykinin | APMGFQGMR-amide 1 | 12752663# Takeuchi H., Yasuda A., Yasuda-Kamatani Y., Kubo T., Nakajima T.; #Identification of a tachykinin-related neuropeptide from the honeybee brain using direct MALDI-TOF MS and its gene expression in worker, queen and drone heads.; # Insect Mol. Biol. 12:291-298(2003).$17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J., Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L., Robinson G.E., Sweedler J.V.; #From the genome to the proteome: uncovering peptides in the Apis brain.; #Science 314:647-649(2006). | |
NP05611 |
APMGFYGTR
|
9 | Apis mellifera | Tachykinin | APMGFYGTR-amide | 12752663# Takeuchi H., Yasuda A., Yasuda-Kamatani Y., Kubo T., Nakajima T.; #Identification of a tachykinin-related neuropeptide from the honeybee brain using direct MALDI-TOF MS and its gene expression in worker, queen and drone heads.; # Insect Mol. Biol. 12:291-298(2003).$17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J., Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L., Robinson G.E., Sweedler J.V.; #From the genome to the proteome: uncovering peptides in the Apis brain.; #Science 314:647-649(2006). | |
NP05612 |
APTGHQEMQ
|
9 | Apis mellifera | Tachykinin | APTGHQEMQ-amide | 12752663#Takeuchi H., Yasuda A., Yasuda-Kamatani Y., Kubo T., Nakajima T.; #Identification of a tachykinin-related neuropeptide from the honeybee brain using direct MALDI-TOF MS and its gene expression in worker, queen and drone heads.; #Insect Mol. Biol. 12:291-298(2003). | |
NP05613 |
ARMGFHGMR
|
9 | Apis mellifera | Tachykinin | ARMGFHGMR-amide | 17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J., Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L., Robinson G.E., Sweedler J.V.; #From the genome to the proteome: uncovering peptides in the Apis brain.; #Science 314:647-649(2006). | |
NP05614 |
APMGFYGT
|
8 | Apis mellifera | Tachykinin | Brain peptide APMGFYGT | 17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J., Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L., Robinson G.E., Sweedler J.V.; #From the genome to the proteome: uncovering peptides in the Apis brain.; #Science 314:647-649(2006). | |
NP05615 |
ASFDDEYY
|
8 | Apis mellifera | Tachykinin | Brain peptide ASFDDEYY | 17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J., Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L., Robinson G.E., Sweedler J.V.; #From the genome to the proteome: uncovering peptides in the Apis brain.; #Science 314:647-649(2006). | |
NP05616 |
EILDEI
|
6 | Apis mellifera | Tachykinin | Brain peptide EILDEI | 17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J., Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L., Robinson G.E., Sweedler J.V.; #From the genome to the proteome: uncovering peptides in the Apis brain.; #Science 314:647-649(2006). | |
NP05617 |
GVMDFQIGLQ
|
10 | Apis mellifera | Tachykinin | Brain peptide GVMDFQIGLQ | 17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J., Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L., Robinson G.E., Sweedler J.V.; #From the genome to the proteome: uncovering peptides in the Apis brain.; #Science 314:647-649(2006). | |
NP05618 |
IILDALEELD
|
10 | Apis mellifera | Tachykinin | Brain peptide IILDALEELD | 17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J., Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L., Robinson G.E., Sweedler J.V.; #From the genome to the proteome: uncovering peptides in the Apis brain.; #Science 314:647-649(2006). | |
NP05619 |
ILDALEELD
|
9 | Apis mellifera | Tachykinin | Brain peptide ILDALEELD | 17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J., Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L., Robinson G.E., Sweedler J.V.; #From the genome to the proteome: uncovering peptides in the Apis brain.; #Science 314:647-649(2006). | |
NP05620 |
NSIINDVKNELFPEDIN
|
17 | Apis mellifera | Tachykinin | Brain peptide NSIINDVKNELFPEDIN | 17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J., Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L., Robinson G.E., Sweedler J.V.; #From the genome to the proteome: uncovering peptides in the Apis brain.; #Science 314:647-649(2006). | |
NP05621 |
SLEEILDEI
|
9 | Apis mellifera | Tachykinin | Brain peptide SLEEILDEI | 17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J., Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L., Robinson G.E., Sweedler J.V.; #From the genome to the proteome: uncovering peptides in the Apis brain.; #Science 314:647-649(2006). | |
NP05622 |
SLEEILDEIK
|
10 | Apis mellifera | Tachykinin | Brain peptide SLEEILDEIK | 17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J., Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L., Robinson G.E., Sweedler J.V.; #From the genome to the proteome: uncovering peptides in the Apis brain.; #Science 314:647-649(2006). | |
NP05623 |
VLSMDGYQNILDKKDELLGEWE
|
22 | Apis mellifera | Tachykinin | Brain peptide VLSMDGYQNILDKKDELLGEWE | 17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J., Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L., Robinson G.E., Sweedler J.V.; #From the genome to the proteome: uncovering peptides in the Apis brain.; #Science 314:647-649(2006). | |
NP05624 |
NPRWEFRGKFVGVR
|
14 | Apis mellifera | Tachykinin | NPRWEFRGKFVGVR-amide | 17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J., Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L., Robinson G.E., Sweedler J.V.; #From the genome to the proteome: uncovering peptides in the Apis brain.; #Science 314:647-649(2006). | |
NP05625 |
SPFRYLGAR
|
9 | Apis mellifera | Tachykinin | SPFRYLGAR-amide | 17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J., Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L., Robinson G.E., Sweedler J.V.; #From the genome to the proteome: uncovering peptides in the Apis brain.; #Science 314:647-649(2006). | |
NP05626 |
TTRFQDSRSKDVYLIDYPEDY
|
21 | Apis mellifera | Tachykinin | TTRFQDSRSKDVYLIDYPEDY-amide | 17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J., Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L., Robinson G.E., Sweedler J.V.; #From the genome to the proteome: uncovering peptides in the Apis brain.; #Science 314:647-649(2006). |