Total number of results for NPY are 226
Download
as Fasta All
| NPID | Sequence | Length | Organism | Family | Name | PMID | Peptide_REF |
|---|---|---|---|---|---|---|---|
| NP03794 | YPPKPENPGDDAAPEELAKYYSALRHYINLITRQRY |
36 | Anguilla rostrata | NPY | Pancreatic polypeptide | 2067973#Conlon JM, Bjenning C, Moon TW, Youson JH, Thim L#Neuropeptide Y-related peptides from the pancreas of a teleostean (eel), holostean (bowfin) and elasmobranch (skate) fish#Peptides 1991 Mar-Apr;12(2):221-6 | |
| NP03795 | YPPKPENPGEDAPPEELAKYYSALRHYINLITRQRY |
36 | Atractosteus spatula | NPY | Pancreatic polypeptide | 3311873#Pollock HG, Kimmel JR, Hamilton JW, Rouse JB, Ebner KE, Lance V, Rawitch AB#Isolation and structures of alligator gar (Lepisosteus spatula) insulin and pancreatic polypeptide#Gen Comp Endocrinol 1987 Sep;67(3):375-82 | |
| NP03796 | APLEPVYPGDNATPEQMAQYAAEMRRYINMLTRPRY |
36 | Chinchilla | NPY | Pancreatic polypeptide | 2235678#Eng J, Kleinman WA, Chu LS#Purification of peptide hormones from chinchilla pancreas by chemical assay#Peptides 1990 Jul-Aug;11(4):683-5 | |
| NP03797 | VPLEPVYPGDNATPEQMAHYAAELRRYINMLTRPRY |
36 | Erinaceus concolor | NPY | Pancreatic polypeptide | 8234904#Marks NJ, Shaw C, Halton DW, Thim L#The primary structure of pancreatic polypeptide from a primitive insectivorous mammal, the European hedgehog (Erinaceous europaeus)#Regul Pept 1993 Sep 3;47(2):179-85 | |
| NP03798 | GPVQPTYPGDDAPVEDLVNDLQQYLNVVTRHRY |
33 | Larus argentatus | NPY | Pancreatic polypeptide | 8174930#Barton CL, Shaw C, Halton DW, Thim L#Isolation and structural characterisation of herring gull (Larus argentatus) pancreatic polypeptide#Gen Comp Endocrinol 1994 Feb;93(2):255-9 | |
| NP03799 | YPPKPENPGEDAPPEELARYYTALRHYINLITRQRY |
36 | Oncorhynchus mykiss | NPY | Neuropeptide Y | 1494498#Barton CL, Shaw C, Halton DW, Thim L#Rainbow trout (Oncorhynchus mykiss) neuropeptide Y#Peptides 1992 Nov-Dec;13(6):1159-63 | |
| NP03800 | YPSKPDNPGEGAPAEDLAKYYSALRHYINLITRQRY |
36 | Scyliorhinus canicula | NPY | Pancreatic polypeptide | 1523163#Conlon JM, Bjenning C, Hazon N#Structural characterization of neuropeptide Y from the brain of the dogfish, Scyliorhinus canicula#Peptides 1992 May-Jun;13(3):493-7 | |
| NP03801 | APLEPAYPGDNATPEQMAQYAAELRKYINMVTRPRY |
36 | Suncus murinus | NPY | Pancreatic polypeptide | 12832102#Hoyle CH, Hill J, Sanger GJ, Andrews PL#Analysis of pancreatic polypeptide cDNA from the house musk shrew, Suncus murinus, suggests a phylogenetically closer relationship with humans than for other small laboratory animal species#Regul Pept 2003 Jul 15;114(2-3):137-44 | |
| NP03802 | KAVRSPSLRLRF |
12 | Aedes aegypti | NPY | sNPF-1 | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
| NP03803 | SPSLRLRF |
8 | Aedes aegypti | NPY | sNPF-1 4-11 | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
| NP03804 | APQLRLRF |
8 | Aedes aegypti | NPY | sNPF-2 | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
| NP03805 | SDPHLSILSKPMSAIPSYKFDD |
22 | Apis mellifera | NPY | Short neuropeptide F | 19576913#Boerjan B, Cardoen D, Bogaerts A, Landuyt B, Schoofs L, Verleyen P#Mass spectrometric profiling of (neuro)-peptides in the worker honeybee, Apis mellifera#Neuropharmacology 2010 Jan;58(1):248-58 | |
| NP03806 | SPSLRLRF |
8 | Apis mellifera | NPY | Short neuropeptide F | 19576913#Boerjan B, Cardoen D, Bogaerts A, Landuyt B, Schoofs L, Verleyen P#Mass spectrometric profiling of (neuro)-peptides in the worker honeybee, Apis mellifera#Neuropharmacology 2010 Jan;58(1):248-58 | |
| NP03807 | PSMRLRF |
7 | Callinectes sapidus | NPY | Short neuropeptide F | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
| NP03808 | PSLRLRF |
7 | Carcinus maenas | NPY | Short neuropeptide F | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP03809 | PSMRLRF |
7 | Carcinus maenas | NPY | Short neuropeptide F | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP03810 | SSPETLISDLLLR |
13 | Coturnix coturnix japonica | NPY | Neuropeptide Y | 20298575#Scholz B, Alm H, Mattsson A, Nilsson A, Kultima K, Savitski MM, Fälth M, Sköld K, Brunström B, Andren PE, Dencker L#Neuropeptidomic analysis of the embryonic Japanese quail diencephalon#BMC Dev Biol 2010 Mar 18;10:30 | |
| NP03811 | DGGDVMSGGEGGEMTAMADAIKYLQGLDKVYGQAARPRF |
39 | Daphnia pulex | NPY | Neuropeptide F | 21830762#Dircksen H, Neupert S, Predel R, Verleyen P, Huybrechts J, Strauss J, Hauser F, Stafflinger E, Schneider M, Pauwels K, Schoofs L, Grimmelikhuijzen CJ#Genomics, transcriptomics, and peptidomics of Daphnia pulex neuropeptides and protein hormones#J Proteome Res 2011 Oct 7;10(10):4478-504 | |
| NP03812 | SDRSPSLRLRF |
11 | Daphnia pulex | NPY | short neuropeptide F | 21830762#Dircksen H, Neupert S, Predel R, Verleyen P, Huybrechts J, Strauss J, Hauser F, Stafflinger E, Schneider M, Pauwels K, Schoofs L, Grimmelikhuijzen CJ#Genomics, transcriptomics, and peptidomics of Daphnia pulex neuropeptides and protein hormones#J Proteome Res 2011 Oct 7;10(10):4478-504 | |
| NP03813 | SPSLRLRF |
8 | Delia radicum | NPY | RLRFamide1–4 | 20869420#Audsley N, Matthews HJ, Down RE, Weaver RJ#Neuropeptides associated with the central nervous system of the cabbage root fly, Delia radicum (L)#Peptides 2011 Mar;32(3):434-40 | |
| NP03814 | KPQRLRW |
7 | Drosophila melanogaster | NPY | sNPF-3 | 20575072#Carlsson MA, Diesner M, Schachtner J, Nässel DR#Multiple neuropeptides in the Drosophila antennal lobe suggest complex modulatory circuits#J Comp Neurol 2010 Aug 15;518(16):3359-80 | |
| NP03815 | KPMRLRW |
7 | Drosophila melanogaster | NPY | sNPF-4 | 20575072#Carlsson MA, Diesner M, Schachtner J, Nässel DR#Multiple neuropeptides in the Drosophila antennal lobe suggest complex modulatory circuits#J Comp Neurol 2010 Aug 15;518(16):3359-80 | |
| NP03816 | PSLRLRF |
7 | Homarus americanus | NPY | Short neuropeptide F | 18304551#Ma M, Chen R, Sousa GL, Bors EK, Kwiatkowski MA, Goiney CC, Goy MF, Christie AE, Li L#Mass spectral characterization of peptide transmitters/hormones in the nervous system and neuroendocrine organs of the American lobster Homarus americanus#Gen Comp Endocrinol 2008 Apr 1;156(2):395-409 | |
| NP03817 | GGRSPSLRLRF |
11 | Ixodes scapularis | NPY | Short neuropeptide F | 19540946#Neupert S, Russell WK, Predel R, Russell DH, Strey OF, Teel PD, Nachman RJ#The neuropeptidomics of Ixodes scapularis synganglion#J Proteomics 2009 Aug 20;72(6):1040-5 | |
| NP03818 | SPSLRLRF |
8 | Ixodes scapularis | NPY | sNPF-1 4-11 | 19540946#Neupert S, Russell WK, Predel R, Russell DH, Strey OF, Teel PD, Nachman RJ#The neuropeptidomics of Ixodes scapularis synganglion#J Proteomics 2009 Aug 20;72(6):1040-5 | |
| NP03819 | GGRSPSLRLRF |
11 | Leptinotarsa decemlineata | NPY | Limulus "NPF" | 8814784#Spittaels K, Verhaert P, Shaw C, Johnston RN, Devreese B, Van Beeumen J, De Loof A#Insect neuropeptide F (NPF)-related peptides: isolation from Colorado potato beetle (Leptinotarsa decemlineata) brain#Insect Biochem Mol Biol 1996 Apr;26(4):375-82 | |
| NP03820 | DGRTPALRLRF |
11 | Litopenaeus vannamei | NPY | Short neuropeptide F | 19852991#Ma M, Gard AL, Xiang F, Wang J, Davoodian N, Lenz PH, Malecha SR, Christie AE, Li L#Combining in silico transcriptome mining and biological mass spectrometry for neuropeptide discovery in the Pacific white shrimp Litopenaeus vannamei#Peptides 2010 Jan;31(1):27-43 | |
| NP03821 | PSLRLRF |
7 | Litopenaeus vannamei | NPY | Short neuropeptide F | 19852991#Ma M, Gard AL, Xiang F, Wang J, Davoodian N, Lenz PH, Malecha SR, Christie AE, Li L#Combining in silico transcriptome mining and biological mass spectrometry for neuropeptide discovery in the Pacific white shrimp Litopenaeus vannamei#Peptides 2010 Jan;31(1):27-43 | |
| NP03822 | PSMRLRF |
7 | Litopenaeus vannamei | NPY | Short neuropeptide F | 19852991#Ma M, Gard AL, Xiang F, Wang J, Davoodian N, Lenz PH, Malecha SR, Christie AE, Li L#Combining in silico transcriptome mining and biological mass spectrometry for neuropeptide discovery in the Pacific white shrimp Litopenaeus vannamei#Peptides 2010 Jan;31(1):27-43 | |
| NP03823 | SMPSLRLRF |
9 | Litopenaeus vannamei | NPY | Short neuropeptide F | 19852991#Ma M, Gard AL, Xiang F, Wang J, Davoodian N, Lenz PH, Malecha SR, Christie AE, Li L#Combining in silico transcriptome mining and biological mass spectrometry for neuropeptide discovery in the Pacific white shrimp Litopenaeus vannamei#Peptides 2010 Jan;31(1):27-43 | |
| NP03824 | AQRSPSLRLRF |
11 | Lucilia cuprina | NPY | Short neuropeptide F-1 | 23280433#Rahman MM, Neupert S, Predel R#Neuropeptidomics of the Australian sheep blowfly Lucilia cuprina (Wiedemann) and related Diptera#Peptides 2013 Mar;41:31-7 | |
| NP03825 | SPSLRLRF |
8 | Lucilia cuprina | NPY | sNPF-1 4-11 | 23280433#Rahman MM, Neupert S, Predel R#Neuropeptidomics of the Australian sheep blowfly Lucilia cuprina (Wiedemann) and related Diptera#Peptides 2013 Mar;41:31-7 | |
| NP03826 | KPQRLRF |
7 | Lucilia cuprina | NPY | sNPF-3 | 23280433#Rahman MM, Neupert S, Predel R#Neuropeptidomics of the Australian sheep blowfly Lucilia cuprina (Wiedemann) and related Diptera#Peptides 2013 Mar;41:31-7 | |
| NP03827 | EPEPMARPTRPKVFESPEELRQYLDLVKEYYSLSGKARY |
39 | Nasonia vitripennis | NPY | Neuropeptide F | 20695486#Hauser F, Neupert S, Williamson M, Predel R, Tanaka Y, Grimmelikhuijzen CJ#Genomics and peptidomics of neuropeptides and protein hormones present in the parasitic wasp Nasonia vitripennis#J Proteome Res 2010 Oct 1;9(10):5296-310 | |
| NP03828 | AAERSPSLRLRF |
12 | Nasonia vitripennis | NPY | Short neuropeptides F | 20695486#Hauser F, Neupert S, Williamson M, Predel R, Tanaka Y, Grimmelikhuijzen CJ#Genomics and peptidomics of neuropeptides and protein hormones present in the parasitic wasp Nasonia vitripennis#J Proteome Res 2010 Oct 1;9(10):5296-310 | |
| NP03829 | FAPRSPQLRLRF |
12 | Nezara viridula | NPY | Short neuropeptide F | 18201800#Predel R, Russell WK, Russell DH, Lopez J, Esquivel J, Nachman RJ#Comparative peptidomics of four related hemipteran species: pyrokinins, myosuppressin, corazonin, adipokinetic hormone, sNPF, and periviscerokinins#Peptides 2008 Feb;29(2):162-7 | |
| NP03830 | SPQLRLRF |
8 | Nezara viridula | NPY | sNPF5–12 | 18201800#Predel R, Russell WK, Russell DH, Lopez J, Esquivel J, Nachman RJ#Comparative peptidomics of four related hemipteran species: pyrokinins, myosuppressin, corazonin, adipokinetic hormone, sNPF, and periviscerokinins#Peptides 2008 Feb;29(2):162-7 | |
| NP03831 | DVRAPALRLRF |
11 | Ocypode ceratophthalma | NPY | Short neuropeptide F | 23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34 | |
| NP03832 | PSLRLRF |
7 | Ocypode ceratophthalma | NPY | Short neuropeptide F | 23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34 | |
| NP03833 | PSMRLRF |
7 | Ocypode ceratophthalma | NPY | Short neuropeptide F | 23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34 | |
| NP03834 | SMPSLRLRF |
9 | Ocypode ceratophthalma | NPY | Short neuropeptide F | 23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34 | |
| NP03835 | QRPPSLKTRF |
10 | Aedes aegypti | NPY | Decapeptide 1 | #Matsumoto S., Brown M.R., Crim J.W., Vigna S.R., Lea A.O.; #Isolation and primary structure of neuropeptides from the mosquito, Aedes aegypti, immunoreactive to FMRFamide antiserum.; #Insect Biochem. 19:277-283(1989). | |
| NP03836 | AVRSPSLRLRF |
11 | Aedes aegypti | NPY | RLRF peptide 1 (By similarity) | ||
| NP03837 | SIRAPQLRLRF |
11 | Aedes aegypti | NPY | RLRF peptide 2 (By similarity) | ||
| NP03838 | AIRAPQLRLRF |
11 | Aedes aegypti | NPY | RLRF peptide 3 (By similarity) | ||
| NP03839 | APSQRLRW |
8 | Aedes aegypti | NPY | RLRW peptide (By similarity) | ||
| NP03840 | TDPLWSSFNENALLEE |
16 | Aedes aegypti | NPY | sNPF peptide 2 (By similarity) | ||
| NP03841 | SGGGMFSTNDVMQQ |
14 | Aedes aegypti | NPY | sNPF peptide 3 (By similarity) | ||
| NP03842 | SDPSVPVEPEDDDMVDQ |
17 | Aedes aegypti | NPY | sNPF-associated peptide (By similarity) | ||
| NP03843 | YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY |
36 | Alligator mississippiensis | NPY | Neuropeptide Y | 8101369#Wang Y., Conlon J.M.; #Neuroendocrine peptides (NPY, GRP, VIP, somatostatin) from the brain and stomach of the alligator.; #Peptides 14:573-579(1993).$8351403#Parker D.B., McRory J.E., Fischer W.H., Park M., Sherwood N.M.; #"Primary structure of neuropeptide Y from brains of the American alligator (Alligator mississippiensis)."; #Regul. Pept. 45:379-386(1993). | |
| NP03844 | YPPKPENPGEDASPEEQAKYYTALRHYINLITRQRY |
36 | Anguilla japonica | NPY | Peptide YY | ||
| NP03845 | AVRSPSLRLRF |
11 | Anopheles gambiae | NPY | RLRF peptide 1 (By similarity) | ||
| NP03846 | AIRAPQLRLRF |
11 | Anopheles gambiae | NPY | RLRF peptide 2 (By similarity) | ||
| NP03847 | TIRAPQLRLRF |
11 | Anopheles gambiae | NPY | RLRF peptide 3 (Probable) | ||
| NP03848 | APSQRLRW |
8 | Anopheles gambiae | NPY | RLRW peptide 1 (Probable) | ||
| NP03849 | APTQRLRW |
8 | Anopheles gambiae | NPY | RLRW peptide 2 (Probable) | ||
| NP03850 | NDPLWTSFNENALLEENFE |
19 | Anopheles gambiae | NPY | sNPF peptide 2 (Probable) | ||
| NP03851 | SNLFGNLVNQFQQDDVMQQ |
19 | Anopheles gambiae | NPY | sNPF peptide 3 (Probable) | ||
| NP03852 | TDPSWAMYNEHQLTTGQQAQPANEASE |
27 | Anopheles gambiae | NPY | sNPF peptide 4 (Probable) | ||
| NP03853 | SDPSVPLRPEEDELIDQ |
17 | Anopheles gambiae | NPY | sNPF-associated peptide (By similarity) | ||
| NP03854 | GKRGDSFRKREFFRTNGERYPEDAAAWTEFQ |
31 | Aplysia californica | NPY | C-flanking peptide of NPY | ||
| NP03855 | DNSEMLAPPPRPEEFTSAQQLRQYLAALNEYYSIMGRPRF |
40 | Aplysia californica | NPY | Neuropeptide Y | 1524828#Rajpara S.M., Garcia P.D., Roberts R., Eliassen J.C., Owens D.F., Maltby D., Myers R.M., Mayeri E.; #Identification and molecular cloning of a neuropeptide Y homolog that produces prolonged inhibition in Aplysia neurons.; #Neuron 9:505-513(1992). | |
| NP03856 | KVVHLRPRSSFSSEDEYQIYLRNVSKYIQLYGRPRF |
36 | Arthurdendyus triangulatus | NPY | Neuropeptide F | 1354101#Curry W.J., Shaw C., Johnston C.F., Thim L., Buchanan K.D.; #Neuropeptide F: primary structure from the tubellarian, Artioposthia triangulata.; #Comp. Biochem. Physiol. 101C:269-274(1992). | |
| NP03857 | SSPETLISDLLMRESTGNIPRTRLEDPSMW |
30 | Bos taurus | NPY | C-flanking peptide of NPY | ||
| NP03858 | YPSKPDNPGEDAPAEDLARYYSALRHYINLITRQRY |
36 | Bos taurus | NPY | Neuropeptide Y | ||
| NP03859 | SSADTLISDLLIGETESHPQTRYEDQLVW |
29 | Carassius auratus | NPY | C-flanking peptide of NPY | ||
| NP03860 | YPTKPDNPGEGAPAEELAKYYSALRHYINLITRQRY |
36 | Carassius auratus | NPY | Neuropeptide Y | ||
| NP03861 | YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY |
36 | Cavia porcellus | NPY | Neuropeptide Y | 3368580#O'Hare M.M.T., Tenmoku S., Aakerlund L., Hilsted L., Johnsen A., Schwartz T.W.; #Neuropeptide Y in guinea pig, rabbit, rat and man. Identical amino acid sequence and oxidation of methionine-17.; #Regul. Pept. 20:293-304(1988). | |
| NP03862 | SSADTLISDLLIGETESHPQTRYEDHLVW |
29 | Cyprinus carpio | NPY | C-flanking peptide of NPY | ||
| NP03863 | YPTKPDNPGEDAPAEELAKYYSALRHYINLITRQRY |
36 | Cyprinus carpio | NPY | Neuropeptide Y | ||
| NP03864 | SSADTLISDLLIGETESRPQTRYEDHLAW |
29 | Danio rerio | NPY | C-flanking peptide of NPY | ||
| NP03865 | YPTKPDNPGEDAPAEELAKYYSALRHYINLITRQRY |
36 | Danio rerio | NPY | Neuropeptide Y | ||
| NP03866 | YPPKPENPGDDAAPEELAKYYTALRHYINLITRQRY |
36 | Danio rerio | NPY | Peptide YY-A | ||
| NP03867 | AQRSPSLRLRF |
11 | Delia radicum | NPY | Short neuropeptide F-1 | 20869420#Audsley N., Matthews H.J., Down R.E., Weaver R.J.; #Neuropeptides associated with the central nervous system of the cabbage root fly, Delia radicum (L).; #Peptides 32:434-440(2011).$22848525#Zoephel J., Reiher W., Rexer K.-H., Kahnt J., Wegener C.; #Peptidomics of the agriculturally damaging larval stage of the cabbage root fly Delia radicum (Diptera: Anthomyiidae).; #PLoS ONE 7:E41543-E41543(2012). | |
| NP03868 | SSPEILDTLVSELLLKESTDQLPQSRYDPSLW |
32 | Dicentrarchus labrax | NPY | C-flanking peptide of NPY | ||
| NP03869 | YPVKPENPGEDAPAEELAKYYSALRHYINLITRQRY |
36 | Dicentrarchus labrax | NPY | Neuropeptide Y | ||
| NP03870 | YPPKPESPGSNASPEDWAKYHAAVRHYVNLITRQRY |
36 | Dicentrarchus labrax | NPY | Peptide Y | ||
| NP03871 | YPAKPASPRDGAPPEELAKYYSALRHYINLITRQRY |
36 | Dicentrarchus labrax | NPY | Peptide YY-like | ||
| NP03872 | NDVNTMADAYKFLQDLDTYYGDRARVRF |
28 | Drosophila melanogaster | NPY | Neuropeptide F | 10499420#Brown M.R., Crim J.W., Arata R.C., Cai H.N., Chun C., Shen P.; #Identification of a Drosophila brain-gut peptide related to the neuropeptide Y family.; #Peptides 20:1035-1042(1999). | |
| NP03873 | AQRSPSLRLRF |
11 | Drosophila melanogaster | NPY | RLRF peptide 1 | ||
| NP03874 | SPSLRLRF |
8 | Drosophila melanogaster | NPY | RLRF peptide 2 | ||
| NP03875 | WFGDVNQKPI |
10 | Drosophila melanogaster | NPY | sNPF peptide 2 | 12171930#Baggerman G., Cerstiaens A., De Loof A., Schoofs L.; #Peptidomics of the larval Drosophila melanogaster central nervous system.; #J. Biol. Chem. 277:40368-40374(2002). | |
| NP03876 | SDPDMLNSIVE |
11 | Drosophila melanogaster | NPY | sNPF-associated peptide | 12171930#Baggerman G., Cerstiaens A., De Loof A., Schoofs L.; #Peptidomics of the larval Drosophila melanogaster central nervous system.; #J. Biol. Chem. 277:40368-40374(2002). | |
| NP03877 | NDVNTMADAYKFLQDLDTYYGDRARVRF |
28 | Drosophila pseudoobscura pseudoobscura | NPY | Neuropeptide F | ||
| NP03878 | AQRSPSLRLRF |
11 | Drosophila pseudoobscura pseudoobscura | NPY | RLRF peptide 1 (By similarity) | ||
| NP03879 | SPSLRLRF |
8 | Drosophila pseudoobscura pseudoobscura | NPY | RLRF peptide 2 (By similarity) | ||
| NP03880 | WFGDVNQKPI |
10 | Drosophila pseudoobscura pseudoobscura | NPY | sNPF peptide 2 (By similarity) | ||
| NP03881 | SDPDMLNNIVE |
11 | Drosophila pseudoobscura pseudoobscura | NPY | sNPF-associated peptide (By similarity) | ||
| NP03882 | YPIKPENPGEDAPADELAKYYSALRHYINLITRQRY |
36 | Gadus morhua | NPY | Neuropeptide Y | 1459125#Jensen J., Conlon J.M.; #Characterization of peptides related to neuropeptide tyrosine and peptide tyrosine-tyrosine from the brain and gastrointestinal tract of teleost fish.; #Eur. J. Biochem. 210:405-410(1992). | |
| NP03883 | SSPETLISDLLLRESTENIPRSRFEDPSMW |
30 | Gallus gallus | NPY | C-flanking peptide of NPY | ||
| NP03884 | YPSKPDSPGEDAPAEDMARYYSALRHYINLITRQRY |
36 | Gallus gallus | NPY | Neuropeptide Y | ||
| NP03885 | STQMLSPPERPREFRHPNELRQYLKELNEYYAIMGRTRF |
39 | Helix aspersa | NPY | Neuropeptide F | 1472263#Leung P.S., Shaw C., Maule A.G., Thim L., Johnston C.F., Irvine G.B.; #The primary structure of neuropeptide F (NPF) from the garden snail, Helix aspersa.; #Regul. Pept. 41:71-81(1992). | |
| NP03886 | SSPETLISDLLMRESTENVPRTRLEDPAMW |
30 | Homo sapiens | NPY | C-flanking peptide of NPY | ||
| NP03887 | YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY |
36 | Homo sapiens | NPY | Neuropeptide Y | ||
| NP03888 | SNTDVLTPDLLFGEAEIRLQSRYDDPLMG |
29 | Ictalurus punctatus | NPY | C-flanking peptide of NPY | ||
| NP03889 | YPTKPENPGEDAPVEELAKYYSALRHYINLITRQRY |
36 | Ictalurus punctatus | NPY | Neuropeptide Y | ||
| NP03890 | FPNKPDSPGEDAPAEDLARYLSAVRHYINLITRQRY |
36 | Lampetra fluviatilis | NPY | Neuropeptide Y | ||
| NP03891 | FPPKPDNPGDNASPEQMARYKAAVRHYINLITRQRY |
36 | Lampetra fluviatilis | NPY | Peptide YY-like | ||
| NP03892 | ARGPQLRLRF |
10 | Leptinotarsa decemlineata | NPY | Neuropeptide NPF-1 | 8814784#Spittaels K., Verhaert P., Shaw C., Johnston R.N., Devreese B., Van Beeumen J., De Loof A.; #Insect neuropeptide F (NPF)-related peptides: isolation from Colorado potato beetle (Leptinotarsa decemlineata) brain.; #Insect Biochem. Mol. Biol. 26:375-382(1996). | |
| NP03893 | APSLRLRF |
8 | Leptinotarsa decemlineata | NPY | Neuropeptide NPF-2 | 8814784#Spittaels K., Verhaert P., Shaw C., Johnston R.N., Devreese B., Van Beeumen J., De Loof A.; #Insect neuropeptide F (NPF)-related peptides: isolation from Colorado potato beetle (Leptinotarsa decemlineata) brain.; #Insect Biochem. Mol. Biol. 26:375-382(1996). | |
| NP03894 | YSQVARPRF |
9 | Locusta migratoria | NPY | Neuropeptide F | 19456328#Clynen E., Husson S.J., Schoofs L.; #Identification of new members of the (short) neuropeptide F family in locusts and Caenorhabditis elegans.; #Ann. N. Y. Acad. Sci. 1163:60-74(2009). | |
| NP03895 | SNRSPSLRLRF |
11 | Locusta migratoria | NPY | Short neuropeptide F | 19456328#Clynen E., Husson S.J., Schoofs L.; #Identification of new members of the (short) neuropeptide F family in locusts and Caenorhabditis elegans.; #Ann. N. Y. Acad. Sci. 1163:60-74(2009). | |
| NP03896 | SPSLRLRF |
8 | Locusta migratoria | NPY | Short neuropeptide F4-11 | 19456328#Clynen E., Husson S.J., Schoofs L.; #Identification of new members of the (short) neuropeptide F family in locusts and Caenorhabditis elegans.; #Ann. N. Y. Acad. Sci. 1163:60-74(2009). | |
| NP03897 | YAIVARPRF |
9 | Loligo vulgaris | NPY | Peptide tyrosine phenylalanine | 1510685#Smart D., Shaw C., Johnston C., Thim L., Halton D., Buchanan K.; #Peptide tyrosine phenylalanine: a novel neuropeptide F-related nonapeptide from the brain of the squid, Loligo vulgaris.; #Biochem. Biophys. Res. Commun. 186:1616-1623(1992). | |
| NP03898 | SSPETLISDLLMRESTENVPRTRLEDPSMW |
30 | Macaca mulatta | NPY | C-flanking peptide of NPY | ||
| NP03899 | YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY |
36 | Macaca mulatta | NPY | Neuropeptide Y | ||
| NP03900 | PDKDFIVNPSDLVLDNKAALRDYLRQINEYFAIIGRPRF |
39 | Moniezia expansa | NPY | Neuropeptide F | #Maule A.G., Shaw C., Halton D.W., Thim L., Johnston C.F., Fairweather I., Buchanan K.D.; #Neuropeptide F: a novel parasitic flatworm regulatory peptide from Moniezia expansa (Cestoda: Cyclophyllidea).; #Parasitology 102:309-316(1991). | |
| NP03901 | SSPETLISDLLMKESTENAPRTRLEDPSMW |
30 | Mus musculus | NPY | C-flanking peptide of NPY | ||
| NP03902 | YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY |
36 | Mus musculus | NPY | Neuropeptide Y | ||
| NP03903 | YPVKPENPGEDAPTEELAKYYTALRHYINLITRQRY |
36 | Oncorhynchus mykiss | NPY | Neuropeptide Y | 1459125#Jensen J., Conlon J.M.; #Characterization of peptides related to neuropeptide tyrosine and peptide tyrosine-tyrosine from the brain and gastrointestinal tract of teleost fish.; #Eur. J. Biochem. 210:405-410(1992). | |
| NP03904 | YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY |
36 | Oryctolagus cuniculus | NPY | Neuropeptide Y | 3368580#O'Hare M.M.T., Tenmoku S., Aakerlund L., Hilsted L., Johnsen A., Schwartz T.W.; #Neuropeptide Y in guinea pig, rabbit, rat and man. Identical amino acid sequence and oxidation of methionine-17.; #Regul. Pept. 20:293-304(1988). | |
| NP03905 | SSPETLISDLLMRESTGNIPRTRLEDPSMW |
30 | Ovis aries | NPY | C-flanking peptide of NPY | ||
| NP03906 | YPSKPDNPGDDAPAEDLARYYSALRHYINLITRQRY |
36 | Ovis aries | NPY | Neuropeptide Y | 2599092#Sillard R., Agerberth B., Mutt V., Joernvall H.; #Sheep neuropeptide Y. A third structural type of a highly conserved peptide.; #FEBS Lett. 258:263-265(1989). | |
| NP03907 | SSPEILDTLVSELLLKESTDTLPQSRYDPSLW |
32 | Paralichthys olivaceus | NPY | C-flanking peptide of NPY | ||
| NP03908 | YPVKPENPGDDAPAEELAKYYSALRHYINLITRQRY |
36 | Paralichthys olivaceus | NPY | Neuropeptide Y | ||
| NP03909 | YPSKPDNPGEDAPAEDMAKYYSALRHYINLITRQRY |
36 | Pelophylax ridibundus | NPY | Melanostatin | 1673794#Chartrel N., Conlon J.M., Danger J.-M., Fournier A., Tonon M.-C., Vaudry H.; #Characterization of melanotropin-release-inhibiting factor (melanostatin) from frog brain: homology with human neuropeptide Y.; #Proc. Natl. Acad. Sci. U.S.A. 88:3862-3866(1991). | |
| NP03910 | RARPRF |
6 | Penaeus monodon | NPY | Peptide tyrosine phenylalanine 1 | 12431727#Sithigorngul P., Pupuem J., Krungkasem C., Longyant S., Panchan N., Chaivisuthangkura P., Sithigorngul W., Petsom A.; #Four novel PYFs: members of NPY/PP peptide superfamily from the eyestalk of the giant tiger prawn Penaeus monodon.; #Peptides 23:1895-1906(2002). | |
| NP03911 | YSQVSRPRF |
9 | Penaeus monodon | NPY | Peptide tyrosine phenylalanine 2 | 12431727#Sithigorngul P., Pupuem J., Krungkasem C., Longyant S., Panchan N., Chaivisuthangkura P., Sithigorngul W., Petsom A.; #Four novel PYFs: members of NPY/PP peptide superfamily from the eyestalk of the giant tiger prawn Penaeus monodon.; #Peptides 23:1895-1906(2002). | |
| NP03912 | YAIAGRPRF |
9 | Penaeus monodon | NPY | Peptide tyrosine phenylalanine 3 | 12431727#Sithigorngul P., Pupuem J., Krungkasem C., Longyant S., Panchan N., Chaivisuthangkura P., Sithigorngul W., Petsom A.; #Four novel PYFs: members of NPY/PP peptide superfamily from the eyestalk of the giant tiger prawn Penaeus monodon.; #Peptides 23:1895-1906(2002). | |
| NP03913 | YSLRARPRF |
9 | Penaeus monodon | NPY | Peptide tyrosine phenylalanine 4 | 12431727#Sithigorngul P., Pupuem J., Krungkasem C., Longyant S., Panchan N., Chaivisuthangkura P., Sithigorngul W., Petsom A.; #Four novel PYFs: members of NPY/PP peptide superfamily from the eyestalk of the giant tiger prawn Penaeus monodon.; #Peptides 23:1895-1906(2002). | |
| NP03914 | YPSKPDNPGEDAPAEDMAKYYSALRHYINLITRQRY |
36 | Rana temporaria | NPY | Melanostatin | 1539111#McKay D.M., Shaw C., Halton D.W., Thim L., Buchanan K.D.; #The primary structure and tissue distribution of an amphibian neuropeptide Y.; #Regul. Pept. 37:143-153(1992). | |
| NP03915 | SSPETLISDLLMRESTENAPRTRLEDPSMW |
30 | Rattus norvegicus | NPY | C-flanking peptide of NPY | ||
| NP03916 | YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY |
36 | Rattus norvegicus | NPY | Neuropeptide Y | 3413293#Corder R., Gaillard R.C., Boehlen P.; #Isolation and sequence of rat peptide YY and neuropeptide Y.; #Regul. Pept. 21:253-261(1988). | |
| NP03917 | NNRSPQLRLRF |
11 | Rhodnius prolixus | NPY | Short neuropeptide F | 19137558#Ons S., Richter F., Urlaub H., Pomar R.R.; #The neuropeptidome of Rhodnius prolixus brain.; #Proteomics 9:788-792(2009). | |
| NP03918 | YSQVARPRF |
9 | Schistocerca gregaria | NPY | Neuropeptide F | 11179815#Schoofs L., Clynen E., Cerstiaens A., Baggerman G., Wei Z., Vercammen T., Nachman R., De Loof A., Tanaka S.; #Newly discovered functions for some myotropic neuropeptides in locusts.; #Peptides 22:219-227(2001).$19456328#Clynen E., Husson S.J., Schoofs L.; #"Identification of new members of the (short) neuropeptide F family in locusts and Caenorhabditis elegans."; #Ann. N. Y. Acad. Sci. 1163:60-74(2009). | |
| NP03919 | SNRSPSLRLRF |
11 | Schistocerca gregaria | NPY | Short neuropeptide F | 19456328#Clynen E., Husson S.J., Schoofs L.; #Identification of new members of the (short) neuropeptide F family in locusts and Caenorhabditis elegans.; #Ann. N. Y. Acad. Sci. 1163:60-74(2009). | |
| NP03920 | SPSLRLRF |
8 | Schistocerca gregaria | NPY | Short neuropeptide F4-11 | 19456328#Clynen E., Husson S.J., Schoofs L.; #Identification of new members of the (short) neuropeptide F family in locusts and Caenorhabditis elegans.; #Ann. N. Y. Acad. Sci. 1163:60-74(2009). | |
| NP03921 | YPSKPDNPGEDAPAEDLARYYSALRHYINLITRQRY |
36 | Sus scrofa | NPY | Neuropeptide Y | 6957876#Tatemoto K.; #Neuropeptide Y: complete amino acid sequence of the brain peptide.; #Proc. Natl. Acad. Sci. U.S.A. 79:5485-5489(1982). | |
| NP03922 | SSPEALMMTDLMLRENAESFPKYRYDEPFMW |
31 | Torpedo marmorata | NPY | C-flanking peptide of NPY | ||
| NP03923 | YPSKPDNPGEGAPAEDLAKYYSALRHYINLITRQRY |
36 | Torpedo marmorata | NPY | Neuropeptide Y | ||
| NP03924 | SNPETMVSDVWWRESTENIPRSRFEDPSMW |
30 | Typhlonectes natans | NPY | C-flanking peptide of NPY | ||
| NP03925 | YPSKPDNPGEDAPAEDMAKYYSALRHYINLITRQRY |
36 | Typhlonectes natans | NPY | Neuropeptide Y | 11287086#Ebersole T.J., Conlon J.M., Goetz F.W., Boyd S.K.; #Characterization and distribution of neuropeptide Y in the brain of a caecilian amphibian.; #Peptides 22:325-334(2001). | |
| NP03926 | SSPETMLSDVWWRENTENIPRSRFEDPPMW |
30 | Xenopus laevis | NPY | C-flanking peptide of NPY | ||
| NP03927 | YPSKPDNPGEDAPAEDMAKYYSALRHYINLITRQRY |
36 | Xenopus laevis | NPY | Neuropeptide Y | ||
| NP03928 | GPSQPTYPGDDAPVEDLIRFYNDLQQYLNVVTRHRY |
36 | Gallus gallus | NPY | Pancreatic polypeptide | 7800847#Marks NJ, Shaw C, Halton DW, Thim L#The corrected primary structure of chicken (avian) pancreatic polypeptide#Regul Pept 1994 Aug 4;52(3):159-64 $1194289#Kimmel J.R., Hayden L.J., Pollock H.G.#Isolation and characterization of a new pancreatic polypeptide hormone.#J. Biol. Chem. 250:9369-9376(1975). | |
| NP03929 | YPPQPESPGGNASPEDWAKYHAAVRHYVNLITRQRY |
36 | Myoxocephalus scorpius | NPY | Pancreatic polypeptide | 3562898#Conlon JM, Schmidt WE, Gallwitz B, Falkmer S, Thim L#Characterization of an amidated form of pancreatic polypeptide from the daddy sculpin (Cottus scorpius)#Regul Pept 1986 Dec 30;16(3-4):261-8 $2883025#Cutfield S.M., Carne A., Cutfield J.F.#The amino-acid sequences of sculpin islet somatostatin-28 and peptide YY.#FEBS Lett. 214:57-61(1987). | |
| NP03930 | APPEPVYPGDDATPEQMAEYVADLRRYINMLTRPRY |
36 | Oryctolagus cuniculus | NPY | Pancreatic polypeptide | 8299350#Marks NJ, Shaw C, Halton DW, Curry WJ, Thim L#Rabbit pancreatic polypeptide#Comp Biochem Physiol B 1993 Dec;106(4):883-7 | |
| NP03931 | YPPKPENPGEDASPEEMTKYLTALRHYINLVTRQRY |
36 | Pelophylax ridibundus | NPY | Pancreatic polypeptide | 1620652#Conlon JM, Chartrel N, Vaudry H#Primary structure of frog PYY: implications for the molecular evolution of the pancreatic polypeptide family#Peptides 1992 Jan-Feb;13(1):145-9 | |
| NP03932 | YPPKPESPGEDASPEEMNKYLTALRHYINLVTRQRY |
36 | Phyllomedusa bicolor | NPY | skin peptide tyrosine-tyrosine | 7937944#Mor A, Chartrel N, Vaudry H, Nicolas P#Skin peptide tyrosine-tyrosine, a member of the pancreatic polypeptide family: isolation, structure, synthesis, and endocrine activity#Proc Natl Acad Sci U S A 1994 Oct 25;91(22):10295-9 | |
| NP03933 | APSEPHHPGDQATQDQLAQYYSDLYQYITFVTRPRF |
36 | Rana temporaria | NPY | Pancreatic polypeptide | 2091068#McKay DM, Shaw C, Thim L, Johnston CF, Halton DW, Fairweather I, Buchanan KD#The complete primary structure of pancreatic polypeptide from the European common frog, Rana temporaria#Regul Pept 1990 Dec 10;31(3):187-97 | |
| NP03934 | YPPKPENPGEDAPPEELAKYYSALRHYINLITRQRY |
36 | Scyliorhinus canicula | NPY | Pancreatic polypeptide | 2019251#Conlon JM, Balasubramaniam A, Hazon N#Structural characterization and biological activity of a neuropeptide Y-related peptide from the dogfish, Scyliorhinus canicula#Endocrinology 1991 May;128(5):2273-9 | |
| NP03935 | APLEPVYPGDDATPEQMAQYAAELRRYINMLTRPRY |
36 | Canis familiaris | NPY | Pancreatic hormone | #Chance R.E., Moon N.E., Johnson M.G.## (In) Jaffe B.M., Behrman H.R. (eds.); Methods of hormone radioimmunoassay (2nd ed.), pp.657-672, Academic Press, New York and London (1979). | |
| NP03936 | DRGEMRDILEWGSPHAAAPR |
20 | Canis familiaris | NPY | Pancreatic icosapeptide | 7031480#Schwartz T.W., Tager H.S.#Isolation and biogenesis of a new peptide from pancreatic islets.#Nature 294:589-591(1981). | |
| NP03937 | APLEPVYPGDDATPQQMAQYAAEMRRYINMLTRPRY |
36 | Cavia porcellus | NPY | Pancreatic hormone | 3575148#Eng J., Huang C.-G., Pan Y.-C., Hulmes J.D., Yalow R.S.#Guinea pig pancreatic polypeptide: structure and pancreatic content.# Peptides 8:165-168(1987). | |
| NP03938 | SAEEDALGLPVWRQSHAAAPGGSHRHPPAGLPAAKGGTGVSGSPPKPWDCLPCRAHSLPSQS |
62 | Cavia porcellus | NPY | Pancreatic icosapeptide-like | 3575148#Eng J., Huang C.-G., Pan Y.-C., Hulmes J.D., Yalow R.S.#Guinea pig pancreatic polypeptide: structure and pancreatic content.# Peptides 8:165-168(1987). | |
| NP03939 | SPLEPVYPGDNATPEEMAQYAAELRRYINMLTRPRY |
36 | Ceratotherium simum | NPY | Pancreatic hormone | 1808025#Henry J.S., Lance V.A., Conlon J.M.#Primary structure of pancreatic polypeptide from four species of Perissodactyla (Przewalski's horse, zebra, rhino, tapir).# Gen. Comp. Endocrinol. 84:440-446(1991). | |
| NP03940 | APLEPVYPGDNATPEQMAQYAAEMRRYINMLTRPRY |
36 | Chinchilla chinchilla | NPY | Pancreatic hormone | 2235678#Eng J., Kleinman W.A., Chu L.S.#Purification of peptide hormones from chinchilla pancreas by chemical assay.# Peptides 11:683-685(1990). | |
| NP03941 | APMEPVYPGDNATPEQMAQYAAELRRYINMLTRPRY |
36 | Equus caballus przewalskii | NPY | Pancreatic hormone | 1808025#Henry J.S., Lance V.A., Conlon J.M.#Primary structure of pancreatic polypeptide from four species of Perissodactyla (Przewalski's horse, zebra, rhino, tapir).# Gen. Comp. Endocrinol. 84:440-446(1991). | |
| NP03942 | APMEPVYPGDNATPEQMAQYAAELRRYINMLTRPRY |
36 | Equus zebra | NPY | Pancreatic hormone | 1808025#Henry J.S., Lance V.A., Conlon J.M.#Primary structure of pancreatic polypeptide from four species of Perissodactyla (Przewalski's horse, zebra, rhino, tapir).# Gen. Comp. Endocrinol. 84:440-446(1991). | |
| NP03943 | VPLEPVYPGDNATPEQMAHYAAELRRYINMLTRPRY |
36 | Erinaceus europaeus | NPY | Pancreatic hormone | 8234904#Marks N.J., Shaw C., Halton D.W., Thim L.#The primary structure of pancreatic polypeptide from a primitive insectivorous mammal, the European hedgehog (Erinaceous europaeus).# Regul. Pept. 47:179-185(1993). | |
| NP03944 | APLEPVYPGDNATPEQMAQYAAELRRYINMLTRPRY |
36 | Felis catus | NPY | Pancreatic hormone | 3827854#Nielsen H.V., Gether U., Schwartz T.W.#Cat pancreatic eicosapeptide and its biosynthetic intermediate. Conservation of a monobasic processing site.# Biochem. J. 240:69-74(1986). | |
| NP03945 | DRGETLDILEWGSPHAAAPR |
20 | Felis catus | NPY | Pancreatic icosapeptide | 3827854#Nielsen H.V., Gether U., Schwartz T.W.#Cat pancreatic eicosapeptide and its biosynthetic intermediate. Conservation of a monobasic processing site.# Biochem. J. 240:69-74(1986). | |
| NP03946 | ASLEPEYPGDNATPEQMAQYAAELRRYINMLTRPRY |
36 | Ovis aries | NPY | Pancreatic hormone | #Chance R.E., Moon N.E., Johnson M.G.## (In) Jaffe B.M., Behrman H.R. (eds.);Methods of hormone radioimmunoassay (2nd ed.), pp.657-672, Academic Press, New York and London (1979). | |
| NP03947 | DKEGTLDFLECGSPHSAVPR |
20 | Ovis aries | NPY | Pancreatic icosapeptide | 6723953#Schwartz T.W., Hansen H.F.#Isolation of ovine pancreatic icosapeptide: a peptide product containing one cysteine residue.#FEBS Lett. 168:293-298(1984). | |
| NP03948 | SSPETLISDLLMREGTENVPRTRLEDPS |
28 | Sus scrofa | NPY | C-flanking peptide of NPY | ||
| NP03949 | APLEPVYPGDDATPEQMAQYAAELRRYINMLTRPRY |
36 | Sus scrofa | NPY | Pancreatic hormone | #Chance R.E., Johnson M.G., Hoffmann J.A., Lin T.-M.## (In) Baba S., Kaneko T., Yanaihara N. (eds.);Proinsulin, insulin, c-peptide, pp.419-425, Excerpta Medica, Amsterdam (1979). | |
| NP03950 | DEEDLLDLKCSSLHAAAPR |
19 | Sus scrofa | NPY | Pancreatic icosapeptide | ||
| NP03951 | APLEPVYPGDNATPEQMAQYAAELRRYINMLTRPRY |
36 | Tapirus pinchaque | NPY | Pancreatic hormone | 1808025#Henry J.S., Lance V.A., Conlon J.M.#Primary structure of pancreatic polypeptide from four species of Perissodactyla (Przewalski's horse, zebra, rhino, tapir).# Gen. Comp. Endocrinol. 84:440-446(1991). | |
| NP03952 | YPTKPESPGPDATPEELAEYMTKIRQYINLVTRQRY |
36 | Varanus eremius | NPY | Goannatyrotoxin-Vere1 | ||
| NP03953 | DKEGTLDFLECGSPHSAVPRY |
21 | Bos taurus | NPY | C-terminal peptide 1 (Potential) | ||
| NP03954 | DKEGTLDFLECGSPHSAVPRWVFSLSCVPRCLGQENGGV |
39 | Bos taurus | NPY | C-terminal peptide 2 (Potential) | ||
| NP03955 | APLEPEYPGDNATPEQMAQYAAELRRYINMLTRPRY |
36 | Bos taurus | NPY | Pancreatic hormone | # Chance R.E., Moon N.E., Johnson M.G.; # # (In) Jaffe B.M., Behrman H.R. (eds.);Methods of hormone radioimmunoassay (2nd ed.), pp.657-672, Academic Press, New York and London (1979). | |
| NP03956 | YPAKPQAPGEHASPDELNRYYTSLRHYLNLVTRQRF |
36 | Bos taurus | NPY | Peptide YY | ||
| NP03957 | APLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRY |
36 | Homo sapiens | NPY | Pancreatic hormone | ||
| NP03958 | HKEDTLAFSEWGSPHAAVPR |
20 | Homo sapiens | NPY | Pancreatic icosapeptide | 6366786# Schwartz T.W., Hansen H.F., Haakanson R., Sundler F., Tager H.S.; # "Human pancreatic icosapeptide: isolation, sequence, and immunocytochemical localization of the COOH-terminal fragment of the pancreatic polypeptide precursor."; # Proc. Natl. Acad. Sci. U.S.A. 81:708-712(1984). | |
| NP03959 | YPIKPEAPREDASPEELNRYYASLRHYLNLVTRQRY |
36 | Homo sapiens | NPY | Peptide YY | 3202875# Tatemoto K., Nakano I., Makk G., Angwin P., Mann M., Schilling J., Go V.L.W.; # "Isolation and primary structure of human peptide YY."; # Biochem. Biophys. Res. Commun. 157:713-717(1988).$2587421#Eberlein G.A., Eysselein V.E., Schaeffer M., Layer P., Grandt D., Goebell H., Niebel W., Davis M., Lee T.D., Shively J.E., Reeve J.R. Jr.; #"A new molecular form of PYY: structural characterization of human PYY(3-36) and PYY(1-36)."; #Peptides 10:797-803(1989). | |
| NP03960 | IKPEAPREDASPEELNRYYASLRHYLNLVTRQRY |
34 | Homo sapiens | NPY | Peptide YY(3-36) | ||
| NP03961 | APLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRY |
36 | Macaca mulatta | NPY | Pancreatic hormone | 2003150# Yu J.-H., Xin Y., Eng J., Yalow R.S.; # "Rhesus monkey gastroenteropancreatic hormones: relationship to human sequences."; # Regul. Pept. 32:39-45(1991). | |
| NP03962 | AEEENTGGLPGVQLSPCTSPPVGLIPCSAPWS |
32 | Mus musculus | NPY | C-terminal peptide | ||
| NP03963 | APLEPMYPGDYATPEQMAQYETQLRRYINTLTRPRY |
36 | Mus musculus | NPY | Pancreatic hormone | ||
| NP03964 | YPAKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY |
36 | Mus musculus | NPY | Peptide YY | ||
| NP03965 | DEDTAGLPGRQLPPCTSLLVGLMPCAAARS |
30 | Rattus norvegicus | NPY | C-terminal peptide | ||
| NP03966 | APLEPMYPGDYATHEQRAQYETQLRRYINTLTRPRY |
36 | Rattus norvegicus | NPY | Pancreatic hormone | ||
| NP03967 | YPAKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY |
36 | Rattus norvegicus | NPY | Peptide YY | 3413293# Corder R., Gaillard R.C., Boehlen P.; # "Isolation and sequence of rat peptide YY and neuropeptide Y."; # Regul. Pept. 21:253-261(1988). | |
| NP03968 | VQNLATFKTMMRY |
13 | Tribolium castaneum | NPY | RYamide-1 | 21843505#Collin C, Hauser F, Krogh-Meyer P, Hansen KK, Gonzalez de Valdivia E, Williamson M, Grimmelikhuijzen CJ#Identification of the Drosophila and Tribolium receptors for the recently discovered insect RYamide neuropeptides#Biochem Biophys Res Commun 2011 Sep 9;412(4):578-83 | |
| NP03969 | ADAFFLGPRY |
10 | Tribolium castaneum | NPY | RYamide-2 | 21843505#Collin C, Hauser F, Krogh-Meyer P, Hansen KK, Gonzalez de Valdivia E, Williamson M, Grimmelikhuijzen CJ#Identification of the Drosophila and Tribolium receptors for the recently discovered insect RYamide neuropeptides#Biochem Biophys Res Commun 2011 Sep 9;412(4):578-83 | |
| NP03970 | GRNDLNFIRY |
10 | Apis mellifera | NPY | TWKSPDIVIRFa–FMRFa-like | 19576913#Boerjan B, Cardoen D, Bogaerts A, Landuyt B, Schoofs L, Verleyen P#Mass spectrometric profiling of (neuro)-peptides in the worker honeybee, Apis mellifera#Neuropharmacology 2010 Jan;58(1):248-58 | |
| NP03971 | EGFYSQRY |
8 | Callinectes sapidus | NPY | RYamide | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
| NP03972 | FVGGSRY |
7 | Callinectes sapidus | NPY | RYamide | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
| NP03973 | FYANRY |
6 | Callinectes sapidus | NPY | RYamide | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
| NP03974 | FYSQRY |
6 | Callinectes sapidus | NPY | RYamide | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
| NP03975 | SGFYANRY |
8 | Callinectes sapidus | NPY | RYamide | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
| NP03976 | SGFYAPRY |
8 | Callinectes sapidus | NPY | RYamide | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
| NP03977 | SRFVGGSRY |
9 | Callinectes sapidus | NPY | RYamide | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
| NP03978 | SSRFVGGSRY |
10 | Callinectes sapidus | NPY | RYamide | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
| NP03979 | VGFYANRY |
8 | Callinectes sapidus | NPY | RYamide | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
| NP03980 | SGYNANRY |
8 | Callinectes sapidus | NPY | RYamide | 22627023#Hui L, Xiang F, Zhang Y, Li L#Mass spectrometric elucidation of the neuropeptidome of a crustacean neuroendocrine organ#Peptides 2012 Aug;36(2):230-9 | |
| NP03981 | PAFYSQRY |
8 | Cancer borealis | NPY | PAFYSQRYa | 14535947#Li L, Kelley WP, Billimoria CP, Christie AE, Pulver SR, Sweedler JV, Marder E#Mass spectrometric investigation of the neuropeptide complement and release in the pericardial organs of the crab, Cancer borealis#J Neurochem 2003 Nov;87(3):642-56 | |
| NP03982 | EGFYSQRY |
8 | Cancer borealis | NPY | RYamide | 18700782#Behrens HL, Chen R, Li L#Combining microdialysis, NanoLC-MS, and MALDI-TOF/TOF to detect neuropeptides secreted in the crab, Cancer borealis#Anal Chem 2008 Sep 15;80(18):6949-58 | |
| NP03983 | FVGGSRY |
7 | Cancer borealis | NPY | RYamide | 18700782#Behrens HL, Chen R, Li L#Combining microdialysis, NanoLC-MS, and MALDI-TOF/TOF to detect neuropeptides secreted in the crab, Cancer borealis#Anal Chem 2008 Sep 15;80(18):6949-58 | |
| NP03984 | FVNSRY |
6 | Cancer borealis | NPY | RYamide | 14535947#Li L, Kelley WP, Billimoria CP, Christie AE, Pulver SR, Sweedler JV, Marder E#Mass spectrometric investigation of the neuropeptide complement and release in the pericardial organs of the crab, Cancer borealis#J Neurochem 2003 Nov;87(3):642-56 | |
| NP03985 | FYANRY |
6 | Cancer borealis | NPY | RYamide | 14535947#Li L, Kelley WP, Billimoria CP, Christie AE, Pulver SR, Sweedler JV, Marder E#Mass spectrometric investigation of the neuropeptide complement and release in the pericardial organs of the crab, Cancer borealis#J Neurochem 2003 Nov;87(3):642-56 | |
| NP03986 | FYSQRY |
6 | Cancer borealis | NPY | RYamide | 17381149#DeKeyser SS, Kutz-Naber KK, Schmidt JJ, Barrett-Wilt GA, Li L#Imaging mass spectrometry of neuropeptides in decapod crustacean neuronal tissues#J Proteome Res 2007 May;6(5):1782-91 | |
| NP03987 | SGFYANRY |
8 | Cancer borealis | NPY | RYamide | 18700782#Behrens HL, Chen R, Li L#Combining microdialysis, NanoLC-MS, and MALDI-TOF/TOF to detect neuropeptides secreted in the crab, Cancer borealis#Anal Chem 2008 Sep 15;80(18):6949-58 | |
| NP03988 | SSRFVGGSRY |
10 | Cancer borealis | NPY | RYamide | 17381149#DeKeyser SS, Kutz-Naber KK, Schmidt JJ, Barrett-Wilt GA, Li L#Imaging mass spectrometry of neuropeptides in decapod crustacean neuronal tissues#J Proteome Res 2007 May;6(5):1782-91 | |
| NP03989 | EGFYSQRY |
8 | Carcinus maenas | NPY | RYamide | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP03990 | FVGGSRY |
7 | Carcinus maenas | NPY | RYamide | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP03991 | FYANRY |
6 | Carcinus maenas | NPY | RYamide | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP03992 | FYSQRY |
6 | Carcinus maenas | NPY | RYamide | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP03993 | SGFYADRY |
8 | Carcinus maenas | NPY | RYamide | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP03994 | SGFYAPRY |
8 | Carcinus maenas | NPY | RYamide | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP03995 | SSRFVGGSRY |
10 | Carcinus maenas | NPY | RYamide | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP03996 | SEVRSRVASRSADERFFGGPRF |
22 | Daphnia pulex | NPY | RYamide 2 | 21830762#Dircksen H, Neupert S, Predel R, Verleyen P, Huybrechts J, Strauss J, Hauser F, Stafflinger E, Schneider M, Pauwels K, Schoofs L, Grimmelikhuijzen CJ#Genomics, transcriptomics, and peptidomics of Daphnia pulex neuropeptides and protein hormones#J Proteome Res 2011 Oct 7;10(10):4478-504 | |
| NP03997 | SGNGGIVLGNSELDARNPERFFIGSRY |
27 | Daphnia pulex | NPY | RYamide 3 | 21830762#Dircksen H, Neupert S, Predel R, Verleyen P, Huybrechts J, Strauss J, Hauser F, Stafflinger E, Schneider M, Pauwels K, Schoofs L, Grimmelikhuijzen CJ#Genomics, transcriptomics, and peptidomics of Daphnia pulex neuropeptides and protein hormones#J Proteome Res 2011 Oct 7;10(10):4478-504 | |
| NP03998 | QTFFTNGRY |
9 | Daphnia pulex | NPY | RYamide 1 | 21830762#Dircksen H, Neupert S, Predel R, Verleyen P, Huybrechts J, Strauss J, Hauser F, Stafflinger E, Schneider M, Pauwels K, Schoofs L, Grimmelikhuijzen CJ#Genomics, transcriptomics, and peptidomics of Daphnia pulex neuropeptides and protein hormones#J Proteome Res 2011 Oct 7;10(10):4478-504 | |
| NP03999 | EGFYSQRY |
8 | Litopenaeus vannamei | NPY | RYamide | 19852991#Ma M, Gard AL, Xiang F, Wang J, Davoodian N, Lenz PH, Malecha SR, Christie AE, Li L#Combining in silico transcriptome mining and biological mass spectrometry for neuropeptide discovery in the Pacific white shrimp Litopenaeus vannamei#Peptides 2010 Jan;31(1):27-43 | |
| NP04000 | SGFYANRY |
8 | Litopenaeus vannamei | NPY | RYamide | 19852991#Ma M, Gard AL, Xiang F, Wang J, Davoodian N, Lenz PH, Malecha SR, Christie AE, Li L#Combining in silico transcriptome mining and biological mass spectrometry for neuropeptide discovery in the Pacific white shrimp Litopenaeus vannamei#Peptides 2010 Jan;31(1):27-43 | |
| NP04001 | SEDRSAGNSLKDSSLFSSARF |
21 | Nasonia vitripennis | NPY | RYamide-2 | 20695486#Hauser F, Neupert S, Williamson M, Predel R, Tanaka Y, Grimmelikhuijzen CJ#Genomics and peptidomics of neuropeptides and protein hormones present in the parasitic wasp Nasonia vitripennis#J Proteome Res 2010 Oct 1;9(10):5296-310 | |
| NP04002 | SEDRNTGNSLRDSSSFFPARY |
21 | Nasonia vitripennis | NPY | RYamide-3 | 20695486#Hauser F, Neupert S, Williamson M, Predel R, Tanaka Y, Grimmelikhuijzen CJ#Genomics and peptidomics of neuropeptides and protein hormones present in the parasitic wasp Nasonia vitripennis#J Proteome Res 2010 Oct 1;9(10):5296-310 | |
| NP04003 | SEDRSTGNSLRDSSSFFPARF |
21 | Nasonia vitripennis | NPY | RYamide-4 | 20695486#Hauser F, Neupert S, Williamson M, Predel R, Tanaka Y, Grimmelikhuijzen CJ#Genomics and peptidomics of neuropeptides and protein hormones present in the parasitic wasp Nasonia vitripennis#J Proteome Res 2010 Oct 1;9(10):5296-310 | |
| NP04004 | SEDRSTGNSLKDSSSFSPARY |
21 | Nasonia vitripennis | NPY | RYamide-5 | 20695486#Hauser F, Neupert S, Williamson M, Predel R, Tanaka Y, Grimmelikhuijzen CJ#Genomics and peptidomics of neuropeptides and protein hormones present in the parasitic wasp Nasonia vitripennis#J Proteome Res 2010 Oct 1;9(10):5296-310 | |
| NP04005 | SEDRSSGNSLKESSFFSPGRY |
21 | Nasonia vitripennis | NPY | RYamide-6 | 20695486#Hauser F, Neupert S, Williamson M, Predel R, Tanaka Y, Grimmelikhuijzen CJ#Genomics and peptidomics of neuropeptides and protein hormones present in the parasitic wasp Nasonia vitripennis#J Proteome Res 2010 Oct 1;9(10):5296-310 | |
| NP04006 | SEGHKNPKELPKFFEIKPRVDQFFIGSRY |
29 | Nasonia vitripennis | NPY | RYamide-7 | 20695486#Hauser F, Neupert S, Williamson M, Predel R, Tanaka Y, Grimmelikhuijzen CJ#Genomics and peptidomics of neuropeptides and protein hormones present in the parasitic wasp Nasonia vitripennis#J Proteome Res 2010 Oct 1;9(10):5296-310 | |
| NP04007 | EGFYSQRY |
8 | Ocypode ceratophthalma | NPY | RYamide | 23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34 | |
| NP04008 | FVGGSRY |
7 | Ocypode ceratophthalma | NPY | RYamide | 23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34 | |
| NP04009 | FYANRY |
6 | Ocypode ceratophthalma | NPY | RYamide | 23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34 | |
| NP04010 | FYSQRY |
6 | Ocypode ceratophthalma | NPY | Ryamide | 23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34 | |
| NP04011 | SGFNSPSPRY |
10 | Ocypode ceratophthalma | NPY | RYamide | 23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34 | |
| NP04012 | SGFYADRY |
8 | Ocypode ceratophthalma | NPY | RYamide | 23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34 | |
| NP04013 | SGFYALRY |
8 | Ocypode ceratophthalma | NPY | RYamide | 23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34 | |
| NP04014 | SGFYANRY |
8 | Ocypode ceratophthalma | NPY | RYamide | 23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34 | |
| NP04015 | SGFYAPRY |
8 | Ocypode ceratophthalma | NPY | RYamide | 23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34 | |
| NP04016 | SGFYCNRY |
8 | Ocypode ceratophthalma | NPY | RYamide | 23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34 | |
| NP04017 | SGFYSDRY |
8 | Ocypode ceratophthalma | NPY | RYamide | 23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34 | |
| NP04018 | SGFYSNRY |
8 | Ocypode ceratophthalma | NPY | RYamide | 23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34 | |
| NP04019 | SSRFVGGSRY |
10 | Ocypode ceratophthalma | NPY | RYamide | 23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34 |