| NPID | NP03854 |
| Name | C-flanking peptide of NPY |
| Organism | Aplysia californica |
| NCBI Taxa ID | 6500 |
| Tissue Specificity | Highly expressed in the abdominal ganglion, to lesser extent in the pleural-pedal ganglion and much lower in the cerebral ganglion. |
| Family | NPY |
| UniProt ID | NPY_APLCA |
| Length | 31 |
| Modification | |
| Gene Ontology | |
| Sequence | GKRGDSFRKREFFRTNGERYPEDAAAWTEFQ |
| Properties | View |
| Structure | NA |
| Reference |