NPID | NP03854 |
Name | C-flanking peptide of NPY |
Organism | Aplysia californica |
NCBI Taxa ID | 6500 |
Tissue Specificity | Highly expressed in the abdominal ganglion, to lesser extent in the pleural-pedal ganglion and much lower in the cerebral ganglion. |
Family | NPY |
UniProt ID | NPY_APLCA |
Length | 31 |
Modification | |
Gene Ontology | |
Sequence | GKRGDSFRKREFFRTNGERYPEDAAAWTEFQ |
Properties | View |
Structure | NA |
Reference |