| NPID | NP03925 |
| Name | Neuropeptide Y |
| Organism | Typhlonectes natans |
| NCBI Taxa ID | 8456 |
| Tissue Specificity | Expressed throughout the brain with highest levels of expression in medial pallium, basal forebrain, preoptic area, midbrain tegmentum and trigeminal nucleus. |
| Family | NPY |
| UniProt ID | NPY_TYPNA |
| Length | 36 |
| Modification | |
| Gene Ontology | |
| Sequence | YPSKPDNPGEDAPAEDMAKYYSALRHYINLITRQRY |
| Properties | View |
| Structure | NA |
| Reference |