NPID | NP03924 |
Name | C-flanking peptide of NPY |
Organism | Typhlonectes natans |
NCBI Taxa ID | 8456 |
Tissue Specificity | Expressed throughout the brain with highest levels of expression in medial pallium, basal forebrain, preoptic area, midbrain tegmentum and trigeminal nucleus. |
Family | NPY |
UniProt ID | NPY_TYPNA |
Length | 30 |
Modification | |
Gene Ontology | |
Sequence | SNPETMVSDVWWRESTENIPRSRFEDPSMW |
Properties | View |
Structure | NA |
Reference |