Total number of results for Corazonin are 63
Download
as Fasta All
NPID | Sequence | Length | Organism | Family | Name | PMID | Peptide_REF |
---|---|---|---|---|---|---|---|
NP01022 |
ETFQYSRGWTN
|
11 | Achatina fulica | Corazonin | Corazonin | 8745159#Araki Y, Liu GJ, Zhang W, Takeuchi H, Munekata E#Further mapping of the Achatina giant neurone types sensitive to the neuroactive peptides isolated from invertebrates#Gen Pharmacol 1995 Dec;26(8):1701-8 | |
NP01023 |
TFQYSRGWTN
|
10 | Periplaneta americana | Corazonin | Corazonin | 2753132#Veenstra JA#Isolation and structure of corazonin, a cardioactive peptide from the American cockroach#FEBS Lett 1989 Jul 3;250(2):231-4 | |
NP01024 |
ETFQYSHGWTN
|
11 | Procambarus clarkii | Corazonin | Corazonin | 14706537#Porras MG, De Loof A, Breuer M, Aréchiga H#Corazonin promotes tegumentary pigment migration in the crayfish Procambarus clarkii#Peptides 2003 Oct;24(10):1581-9 | |
NP01025 |
ETFQYSHGWTN
|
11 | Schistocerca americana | Corazonin | Corazonin | 1815215#Veenstra JA#Presence of corazonin in three insect species, and isolation and identification of [His7]corazonin from Schistocerca americana#Peptides 1991 Nov-Dec;12(6):1285-9 | |
NP01026 |
SFSENMINDHRQPAPTNNNY
|
20 | Apis mellifera | Corazonin | Corazonin | 19576913#Boerjan B, Cardoen D, Bogaerts A, Landuyt B, Schoofs L, Verleyen P#Mass spectrometric profiling of (neuro)-peptides in the worker honeybee, Apis mellifera#Neuropharmacology 2010 Jan;58(1):248-58 | |
NP01027 |
QTFQYSRGWTN
|
11 | Cancer borealis | Corazonin | Corazonin | 14535947#Li L, Kelley WP, Billimoria CP, Christie AE, Pulver SR, Sweedler JV, Marder E#Mass spectrometric investigation of the neuropeptide complement and release in the pericardial organs of the crab, Cancer borealis#J Neurochem 2003 Nov;87(3):642-56 | |
NP01028 |
QTFQYSRGWTN
|
11 | Carcinus maenas | Corazonin | Corazonin | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
NP01029 |
QTFQYSRGWTN
|
11 | Daphnia pulex | Corazonin | Corazonin | 21830762#Dircksen H, Neupert S, Predel R, Verleyen P, Huybrechts J, Strauss J, Hauser F, Stafflinger E, Schneider M, Pauwels K, Schoofs L, Grimmelikhuijzen CJ#Genomics, transcriptomics, and peptidomics of Daphnia pulex neuropeptides and protein hormones#J Proteome Res 2011 Oct 7;10(10):4478-504 | |
NP01030 |
ETFQYSRGWTN
|
11 | Delia radicum | Corazonin | Corazonin | 20869420#Audsley N, Matthews HJ, Down RE, Weaver RJ#Neuropeptides associated with the central nervous system of the cabbage root fly, Delia radicum (L)#Peptides 2011 Mar;32(3):434-40 | |
NP01031 |
FQYSRGWTN
|
9 | Drosophila melanogaster | Corazonin | Corazonin3-11 | 16441518#Wegener C, Reinl T, Jänsch L, Predel R#Direct mass spectrometric peptide profiling and fragmentation of larval peptide hormone release sites in Drosophila melanogaster reveals tagma-specific peptide expression and differential processing#J Neurochem 2006 Mar;96(5):1362-74 | |
NP01032 |
QTFQYSRGWTN
|
11 | Homarus americanus | Corazonin | Corazonin | 20025296#Chen R, Jiang X, Conaway MC, Mohtashemi I, Hui L, Viner R, Li L#Mass spectral analysis of neuropeptide expression and distribution in the nervous system of the lobster Homarus americanus#J Proteome Res 2010 Feb 5;9(2):818-32 | |
NP01033 |
QTFQYSRGWTN
|
11 | Ixodes scapularis | Corazonin | Corazonin | 19540946#Neupert S, Russell WK, Predel R, Russell DH, Strey OF, Teel PD, Nachman RJ#The neuropeptidomics of Ixodes scapularis synganglion#J Proteomics 2009 Aug 20;72(6):1040-5 | |
NP01034 |
QTFQYSRGWTN
|
11 | Lucilia cuprina | Corazonin | Corazonin | 23280433#Rahman MM, Neupert S, Predel R#Neuropeptidomics of the Australian sheep blowfly Lucilia cuprina (Wiedemann) and related Diptera#Peptides 2013 Mar;41:31-7 | |
NP01035 |
ETFQYSRGWTN
|
11 | Manduca sexta | Corazonin | Corazonin | 14599724#Audsley N, Weaver RJ#A comparison of the neuropeptides from the retrocerebral complex of adult male and female Manduca sexta using MALDI-TOF mass spectrometry#Regul Pept 2003 Nov 15;116(1-3):127-37 | |
NP01036 |
QTFQYSRGWTN
|
11 | Nasonia vitripennis | Corazonin | Corazonin | 20695486#Hauser F, Neupert S, Williamson M, Predel R, Tanaka Y, Grimmelikhuijzen CJ#Genomics and peptidomics of neuropeptides and protein hormones present in the parasitic wasp Nasonia vitripennis#J Proteome Res 2010 Oct 1;9(10):5296-310 | |
NP01037 |
QTFQYSRGWTN
|
11 | Nezara viridula | Corazonin | corazonin | 18201800#Predel R, Russell WK, Russell DH, Lopez J, Esquivel J, Nachman RJ#Comparative peptidomics of four related hemipteran species: pyrokinins, myosuppressin, corazonin, adipokinetic hormone, sNPF, and periviscerokinins#Peptides 2008 Feb;29(2):162-7 | |
NP01038 |
QTFQYSRGWTN
|
11 | Sarcophaga bullata | Corazonin | Corazonin | 15033466#Verleyen P, Huybrechts J, Sas F, Clynen E, Baggerman G, De Loof A, Schoofs L#Neuropeptidomics of the grey flesh fly, Neobellieria bullata#Biochem Biophys Res Commun 2004 Apr 9;316(3):763-70 | |
NP01039 |
QTFQYSRGWTN
|
11 | Aedes aegypti | Corazonin | Corazonin | ||
NP01040 |
SSPEQTAPSRTLLPHIPLGMDKPDEECRLLIQ
|
32 | Aedes aegypti | Corazonin | Corazonin precursor-related peptide | ||
NP01041 |
QTFQYSRGWTNGKRSSPEQTAPSRTLLPHIPLGMDKPDEECRLLIQRFLKSPCDVRLANAIVNRNKDLLRDMADDVNDGTALLYDPVPMVDTAASEDVRFKRGTPDRRLLNDGMHRL
|
117 | Aedes aegypti | Corazonin | Pro-corazonin (Potential) | ||
NP01042 |
QTFQYSRGWTN
|
11 | Anopheles gambiae | Corazonin | Corazonin | ||
NP01043 |
SPLSSSSSSPSSSAAMEPLTANQLLASALSSGGLNSLKPSEKALL
|
45 | Anopheles gambiae | Corazonin | Corazonin precursor-related peptide | ||
NP01044 |
QTFQYSRGWTNGKRSPLSSSSSSPSSSAAMEPLTANQLLASALSSGGLNSLKPSEKALLRRFLRNPCDLRVASLLAAAHPTKELFPLAGNSFDSAESAGAAFVLPPFLMDPDESNGGIGGSNLANGRSMEDELRFKRGTATGFSDHRQKIA
|
151 | Anopheles gambiae | Corazonin | Pro-corazonin (Potential) | ||
NP01045 |
QTFTYSHGWTN
|
11 | Apis mellifera | Corazonin | Corazonin | 16406615# Verleyen P., Baggerman G., Mertens I., Vandersmissen T., Huybrechts J., Van Lommel A., De Loof A., Schoofs L.; #Cloning and characterization of a third isoform of corazonin in the honey bee Apis mellifera.; # Peptides 27:493-499(2006).$17068263#Hummon A.B., Richmond T.A., Verleyen P., Baggerman G., Huybrechts J., Ewing M.A., Vierstraete E., Rodriguez-Zas S.L., Schoofs L., Robinson G.E., Sweedler J.V.; #From the genome to the proteome: uncovering peptides in the Apis brain.; #Science 314:647-649(2006). | |
NP01046 |
STSLEELANRNAIQSDNVFANCELQKLRLLLQGNINNQLFQTPCELLNFP
|
50 | Apis mellifera | Corazonin | Corazonin precursor-related peptide | ||
NP01047 |
QTFTYSHGWTNGKRSTSLEELANRNAIQSDNVFANCELQKLRLLLQGNINNQLFQTPCELLNFPKRSFSENMINDHRQPAPTNNNY
|
86 | Apis mellifera | Corazonin | Pro-corazonin (Potential) | ||
NP01048 |
QTFHYSQGWTN
|
11 | Austrophasma gansbaaiense | Corazonin | Corazonin | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.;#Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).;#Syst. Biol. 61:609-629(2012). | |
NP01049 |
QTFHYSQGWTN
|
11 | Austrophasma rawsonvillense | Corazonin | Corazonin | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.;#Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).;#Syst. Biol. 61:609-629(2012). | |
NP01050 |
QTFQYSRGWTN
|
11 | Bombyx mori | Corazonin | Corazonin | ||
NP01051 |
DGHKRDELRDEVLERILTPCQLDKLKYVLEGKPLNDRLFVPCDYIEEEVNQPKRYKGERNHELFDVFQ
|
68 | Bombyx mori | Corazonin | Corazonin precursor-related peptide | ||
NP01052 |
QTFQYSRGWTNGKRDGHKRDELRDEVLERILTPCQLDKLKYVLEGKPLNDRLFVPCDYIEEEVNQPKRYKGERNHELFDVFQ
|
82 | Bombyx mori | Corazonin | Pro-corazonin (Potential) | ||
NP01053 |
QTFQYSRGWTN
|
11 | Delia radicum | Corazonin | Corazonin | 20869420#Audsley N., Matthews H.J., Down R.E., Weaver R.J.; #Neuropeptides associated with the central nervous system of the cabbage root fly, Delia radicum (L).; #Peptides 32:434-440(2011). | |
NP01054 |
FQYSRGWTN
|
9 | Delia radicum | Corazonin | Corazonin(3-11) | 20869420#Audsley N., Matthews H.J., Down R.E., Weaver R.J.; #Neuropeptides associated with the central nervous system of the cabbage root fly, Delia radicum (L).; #Peptides 32:434-440(2011). | |
NP01055 |
QTFQYSRGWTN
|
11 | Drosophila erecta | Corazonin | Corazonin | ||
NP01056 |
SFNAASPLLTTGHLHRGSELGLSDLYDLQEWTSD
|
34 | Drosophila erecta | Corazonin | Corazonin precursor-related peptide | ||
NP01057 |
QTFQYSRGWTNGKRSFNAASPLLTTGHLHRGSELGLSDLYDLQEWTSDRRLERCLSQLQRSLIARNCVPGSDFNANRVDPDPESSAHPRLGNINNENVLYSSANVPTRHRQSNELLEELSAAGGASAEPNVFGKH
|
135 | Drosophila erecta | Corazonin | Pro-corazonin (Potential) | ||
NP01058 |
QTFQYSRGWTN
|
11 | Drosophila melanogaster | Corazonin | Corazonin | 12171930#Baggerman G., Cerstiaens A., De Loof A., Schoofs L.; #Peptidomics of the larval Drosophila melanogaster central nervous system.; #J. Biol. Chem. 277:40368-40374(2002). | |
NP01059 |
SFNAASPLLANGHLHRASELGLTDLYDLQDWSSD
|
34 | Drosophila melanogaster | Corazonin | Corazonin precursor-related peptide | ||
NP01060 |
QTFQYSRGWTNGKRSFNAASPLLANGHLHRASELGLTDLYDLQDWSSDRRLERCLSQLQRSLIARNCVPGSDFNANRVDPDPENSAHPRLSNSNGENVLYSSANIPNRHRQSNELLEELSAAGGASAEPNVFGKH
|
135 | Drosophila melanogaster | Corazonin | Pro-corazonin (Potential) | ||
NP01061 |
QTFQYSRGWTN
|
11 | Drosophila pseudoobscura pseudoobscura | Corazonin | Corazonin | ||
NP01062 |
ALTPPSLLSHGHFNRASDLGFSDLYDVQDWSSE
|
33 | Drosophila pseudoobscura pseudoobscura | Corazonin | Corazonin precursor-related peptide | ||
NP01063 |
QTFQYSRGWTNGKRALTPPSLLSHGHFNRASDLGFSDLYDVQDWSSERRLERCLAQLQRSLLSRVYGSVVDFNANRPEPDSSDSGSSRNRANNNNENVLYPTPIQNRHHSSNELLEEISAAVAGSGPTGAGSGEPSVFGKH
|
141 | Drosophila pseudoobscura pseudoobscura | Corazonin | Pro-corazonin (Potential) | ||
NP01064 |
QTFQYSRGWTN
|
11 | Drosophila simulans | Corazonin | Corazonin | ||
NP01065 |
SFNAASPLLANGHLHRGSELGLTDLYDLQDWSSD
|
34 | Drosophila simulans | Corazonin | Corazonin precursor-related peptide | ||
NP01066 |
QTFQYSRGWTNGKRSFNAASPLLANGHLHRGSELGLTDLYDLQDWSSDRRLERCLSQLQRSLIARNCVPGSDFNANRVDPDPENSVHPRLSNINGENVLYSSANIPNRHRQSNELLEELSAAGGASAEPNVFGKH
|
135 | Drosophila simulans | Corazonin | Pro-corazonin (Potential) | ||
NP01067 |
QTFQYSRGWTN
|
11 | Drosophila virilis | Corazonin | Corazonin | ||
NP01068 |
APPAALVTNGHNLGLLDIYDIQDRPTDI
|
28 | Drosophila virilis | Corazonin | Corazonin precursor-related peptide | ||
NP01069 |
QTFQYSRGWTNGKRAPPAALVTNGHNLGLLDIYDIQDRPTDIKLERCLLQLQHFVGNALLHRSFANGLAYSASRPDPETDVRSINIHSRPGSGNNNIENSLYPNVNHRQSNELFEALNAPGPDAVEPNDYGKH
|
133 | Drosophila virilis | Corazonin | Pro-corazonin (Potential) | ||
NP01070 |
QTFQYSRGWTN
|
11 | Galleria mellonella | Corazonin | Corazonin | 11520357#Hansen I.A., Sehnal F., Meyer S.R., Scheller K.; #Corazonin gene expression in the waxmoth Galleria mellonella.; #Insect Mol. Biol. 10:341-346(2001). | |
NP01071 |
DGHKTEDIRDLTNNLERILSPCQMNKLKYVLEGKPLNERLLGPCDTSKTRSTTNPSDTNTSAVKTPCSTHFNKHCYSFSY
|
80 | Galleria mellonella | Corazonin | Corazonin precursor-related peptide | ||
NP01072 |
QTFQYSRGWTNGKRDGHKTEDIRDLTNNLERILSPCQMNKLKYVLEGKPLNERLLGPCDTSKTRSTTNPSDTNTSAVKTPCSTHFNKHCYSFSY
|
94 | Galleria mellonella | Corazonin | Pro-corazonin (Potential) | ||
NP01073 |
QTFHYSQGWTN
|
11 | Hemilobophasma montaguense | Corazonin | Corazonin | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
NP01074 |
QTFHYSQGWTN
|
11 | Karoophasma biedouwense | Corazonin | Corazonin | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
NP01075 |
QTFHYSQGWTN
|
11 | Karoophasma botterkloofense | Corazonin | Corazonin | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
NP01076 |
QTFHYSQGWTN
|
11 | Lobatophasma redelinghuysense | Corazonin | Corazonin | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
NP01077 |
QTFQYSRGWTN
|
11 | Mantophasma kudubergense | Corazonin | Corazonin | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
NP01078 |
QTFHYSQGWTN
|
11 | Namaquaphasma ookiepense | Corazonin | Corazonin | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
NP01079 |
QTFQYSRGWTN
|
11 | Pachyphasma brandbergense | Corazonin | Corazonin | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
NP01080 |
QTFQYSRGWTN
|
11 | Periplaneta americana | Corazonin | Corazonin | 2753132#Veenstra J.A.; #Isolation and structure of corazonin, a cardioactive peptide from the American cockroach.; #FEBS Lett. 250:231-234(1989). | |
NP01081 |
QTFQYSRGWTN
|
11 | Praedatophasma maraisi | Corazonin | Corazonin | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
NP01082 |
QTFQYSRGWTN
|
11 | Rhodnius prolixus | Corazonin | Corazonin | 19137558#Ons S., Richter F., Urlaub H., Pomar R.R.; #The neuropeptidome of Rhodnius prolixus brain.; #Proteomics 9:788-792(2009). | |
NP01083 |
QTFQYSRGWTN
|
11 | Striatophasma naukluftense | Corazonin | Corazonin | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). | |
NP01084 |
QTFQYSRGWTN
|
11 | Tyrannophasma gladiator | Corazonin | Corazonin | 22508719#Predel R., Neupert S., Huetteroth W., Kahnt J., Waidelich D., Roth S.; #Peptidomics-based phylogeny and biogeography of Mantophasmatodea (Hexapoda).; #Syst. Biol. 61:609-629(2012). |