Neuropeptide
NPID NP01059
Name Corazonin precursor-related peptide
Organism Drosophila melanogaster
NCBI Taxa ID 7227
Tissue Specificity From late embryo to larva, expression is consistently detected in three neuronal groups: dorso-lateral neurons (DL), dorso-medial neurons (DM), and neurons in the ventral nerve cord (vCrz). Both the vCrz and DM groups die via programmed cell death during metamorphosis, whereas the DL neurons persist to adulthood. In adults, expression is seen in a cluster of six to eight neurons per lobe in the pars lateralis (DLP), in numerous neuronal cells in the optic lobes, and in a novel group of four abdominal ganglionic neurons present only in males (ms- aCrz). Projections of the ms-aCrz neurons terminate within the ventral nerve cord, implying a role as interneurons. Terminals of the DLP neurons are found in the retrocerebral complex that produces juvenile hormone and adipokinetic hormone, located in the vicinity of terminals emanating from PDF-containing pacemaking neurons.
Family Corazonin
UniProt ID CORZ_DROME
Length 34
Modification
Gene Ontology
Sequence SFNAASPLLANGHLHRASELGLTDLYDLQDWSSD
Properties View
Structure NA
Reference