| NPID | NP01069 |
| Name | Pro-corazonin (Potential) |
| Organism | Drosophila virilis |
| NCBI Taxa ID | 7244 |
| Tissue Specificity | Expression is restricted to 24 neurons in the larval CNS (8 in the brain and 16 in the ventral nerve cord) and 12-16 neurons in the pars lateralis of the adult brain. |
| Family | Corazonin |
| UniProt ID | CORZ_DROVI |
| Length | 133 |
| Modification | |
| Gene Ontology | |
| Sequence | QTFQYSRGWTNGKRAPPAALVTNGHNLGLLDIYDIQDRPTDIKLERCLLQLQHFVGNALLHRSFANGLAYSASRPDPETDVRSINIHSRPGSGNNNIENSLYPNVNHRQSNELFEALNAPGPDAVEPNDYGKH |
| Properties | View |
| Structure | |
| Reference |