| NPID | NP01056 |
| Name | Corazonin precursor-related peptide |
| Organism | Drosophila erecta |
| NCBI Taxa ID | 7220 |
| Tissue Specificity | Expression is restricted to 24 neurons in the larval CNS (8 in the brain and 16 in the ventral nerve cord) and 12-16 neurons in the pars lateralis of the adult brain. |
| Family | Corazonin |
| UniProt ID | CORZ_DROER |
| Length | 34 |
| Modification | |
| Gene Ontology | |
| Sequence | SFNAASPLLTTGHLHRGSELGLSDLYDLQEWTSD |
| Properties | View |
| Structure | NA |
| Reference |
Neuropeptide