Total number of results for Penaeus monodon are 52
Download
as Fasta All
| NPID | Sequence | Length | Organism | Family | Name | PMID | Peptide_REF |
|---|---|---|---|---|---|---|---|
| NP00258 | ANQYTFGL |
8 | Penaeus monodon | Allatostatin | Allatostatin | 12126730#Duve H, Johnsen AH, Scott AG, Thorpe A#Allatostatins of the tiger prawn, Penaeus monodon (Crustacea: Penaeidea)#Peptides 2002 Jun;23(6):1039-51 | |
| NP00259 | ASQYTFGL |
8 | Penaeus monodon | Allatostatin | Allatostatin | 12126730#Duve H, Johnsen AH, Scott AG, Thorpe A#Allatostatins of the tiger prawn, Penaeus monodon (Crustacea: Penaeidea)#Peptides 2002 Jun;23(6):1039-51 | |
| NP00501 | ANEDEDAASLFAFGL |
15 | Penaeus monodon | Allatostatin | Allatostatin | 21459120#Chansela P, Goto-Inoue N, Zaima N, Sroyraya M, Sobhon P, Setou M#Visualization of neuropeptides in paraffin-embedded tissue sections of the central nervous system in the decapod crustacean, Penaeus monodon, by imaging mass spectrometry#Peptides 2012 Mar;34(1):10-8 | |
| NP00502 | SGHYNFGL |
8 | Penaeus monodon | Allatostatin | Allatostatin A | 21459120#Chansela P, Goto-Inoue N, Zaima N, Sroyraya M, Sobhon P, Setou M#Visualization of neuropeptides in paraffin-embedded tissue sections of the central nervous system in the decapod crustacean, Penaeus monodon, by imaging mass spectrometry#Peptides 2012 Mar;34(1):10-8 | |
| NP00679 | HEEYQAHVQTV |
11 | Penaeus monodon | Arthropod CHH/MIH/GIH/VIH hormone | Crustacean hyperglycaemic hormones | 21459120#Chansela P, Goto-Inoue N, Zaima N, Sroyraya M, Sobhon P, Setou M#Visualization of neuropeptides in paraffin-embedded tissue sections of the central nervous system in the decapod crustacean, Penaeus monodon, by imaging mass spectrometry#Peptides 2012 Mar;34(1):10-8 | |
| NP00680 | AHVQTVGK |
8 | Penaeus monodon | Arthropod CHH/MIH/GIH/VIH hormone | Crustacean hyperglycemic hormone | 21459120#Chansela P, Goto-Inoue N, Zaima N, Sroyraya M, Sobhon P, Setou M#Visualization of neuropeptides in paraffin-embedded tissue sections of the central nervous system in the decapod crustacean, Penaeus monodon, by imaging mass spectrometry#Peptides 2012 Mar;34(1):10-8 | |
| NP00717 | DALSPPAAGLGADHSFT |
17 | Penaeus monodon | Arthropod CHH/MIH/GIH/VIH hormone | CHH precursor-related peptide 1 | ||
| NP00718 | SLFDPSCTGVFDRQLLRRLSRVCDDCFNVFREPNVATECRSNCYNNEVFRQCMEYLLPAHLHEEHRLAVQMV |
72 | Penaeus monodon | Arthropod CHH/MIH/GIH/VIH hormone | Crustacean hyperglycemic hormone 1 | ||
| NP00719 | RSLEGSSSPVASLIRGRSLS |
20 | Penaeus monodon | Arthropod CHH/MIH/GIH/VIH hormone | CHH precursor-related peptide 2 | ||
| NP00720 | ANFDPSCAGVYNRELLGRLSRLCDDCYNVFREPKVATECRSNCFYNPVFVQCLEYLIPADLHEEYQAHVQTV |
72 | Penaeus monodon | Arthropod CHH/MIH/GIH/VIH hormone | Crustacean hyperglycemic hormone 2 | ||
| NP00721 | RSFN |
4 | Penaeus monodon | Arthropod CHH/MIH/GIH/VIH hormone | CHH precursor-related peptide 3 | ||
| NP00722 | ANFDPSCAGVYNRELLGRLSRLCDDCYNVFREPKVATECRNNCFYNPVFVQCLEYLIPADLHEEYQAHVQTV |
72 | Penaeus monodon | Arthropod CHH/MIH/GIH/VIH hormone | Crustacean hyperglycemic hormone 3 | ||
| NP00723 | RSLDASPSSAFSGNHSLS |
18 | Penaeus monodon | Arthropod CHH/MIH/GIH/VIH hormone | CHH precursor-related peptide 4 | ||
| NP00724 | SLFDPACTGIYDRQLLGKLGRLCDDCYNVFREPKVATGCRSNCYYNLIFLDCLEYLIPSHLQEEHMEALQTV |
72 | Penaeus monodon | Arthropod CHH/MIH/GIH/VIH hormone | Crustacean hyperglycemic hormone 4 | ||
| NP00725 | ANFDPSCAGVYDRELLGGLSRLCDDCYNVFREPKVATECRSNCFYNSVFVQCLEYLIPADLHEEYQAHVQTV |
72 | Penaeus monodon | Arthropod CHH/MIH/GIH/VIH hormone | Crustacean hyperglycemic hormone 5 | ||
| NP00745 | AAQILRVAQGPSAFVAGPH |
19 | Penaeus monodon | Arthropod PDH | Pigment-dispersing hormone | 21459120#Chansela P, Goto-Inoue N, Zaima N, Sroyraya M, Sobhon P, Setou M#Visualization of neuropeptides in paraffin-embedded tissue sections of the central nervous system in the decapod crustacean, Penaeus monodon, by imaging mass spectrometry#Peptides 2012 Mar;34(1):10-8 | |
| NP00746 | LINSILGLPK |
10 | Penaeus monodon | Arthropod PDH | Pigment-dispersing hormone | 21459120#Chansela P, Goto-Inoue N, Zaima N, Sroyraya M, Sobhon P, Setou M#Visualization of neuropeptides in paraffin-embedded tissue sections of the central nervous system in the decapod crustacean, Penaeus monodon, by imaging mass spectrometry#Peptides 2012 Mar;34(1):10-8 | |
| NP00747 | LINSLLGIPKVMNDA |
15 | Penaeus monodon | Arthropod PDH | Pigment-dispersing hormone | 21459120#Chansela P, Goto-Inoue N, Zaima N, Sroyraya M, Sobhon P, Setou M#Visualization of neuropeptides in paraffin-embedded tissue sections of the central nervous system in the decapod crustacean, Penaeus monodon, by imaging mass spectrometry#Peptides 2012 Mar;34(1):10-8 | |
| NP00748 | LINSLLGIPKVMTDA |
15 | Penaeus monodon | Arthropod PDH | Pigment-dispersing hormone | 21459120#Chansela P, Goto-Inoue N, Zaima N, Sroyraya M, Sobhon P, Setou M#Visualization of neuropeptides in paraffin-embedded tissue sections of the central nervous system in the decapod crustacean, Penaeus monodon, by imaging mass spectrometry#Peptides 2012 Mar;34(1):10-8 | |
| NP00749 | LLGIPKVMNDA |
11 | Penaeus monodon | Arthropod PDH | Pigment-dispersing hormone | 21459120#Chansela P, Goto-Inoue N, Zaima N, Sroyraya M, Sobhon P, Setou M#Visualization of neuropeptides in paraffin-embedded tissue sections of the central nervous system in the decapod crustacean, Penaeus monodon, by imaging mass spectrometry#Peptides 2012 Mar;34(1):10-8 | |
| NP00750 | NSELINSLLGIP |
12 | Penaeus monodon | Arthropod PDH | Pigment-dispersing hormone | 21459120#Chansela P, Goto-Inoue N, Zaima N, Sroyraya M, Sobhon P, Setou M#Visualization of neuropeptides in paraffin-embedded tissue sections of the central nervous system in the decapod crustacean, Penaeus monodon, by imaging mass spectrometry#Peptides 2012 Mar;34(1):10-8 | |
| NP00751 | NSELINSLLGIPK |
13 | Penaeus monodon | Arthropod PDH | Pigment-dispersing hormone | 21459120#Chansela P, Goto-Inoue N, Zaima N, Sroyraya M, Sobhon P, Setou M#Visualization of neuropeptides in paraffin-embedded tissue sections of the central nervous system in the decapod crustacean, Penaeus monodon, by imaging mass spectrometry#Peptides 2012 Mar;34(1):10-8 | |
| NP00752 | NSELINSLLGIPKVM |
15 | Penaeus monodon | Arthropod PDH | Pigment-dispersing hormone | 21459120#Chansela P, Goto-Inoue N, Zaima N, Sroyraya M, Sobhon P, Setou M#Visualization of neuropeptides in paraffin-embedded tissue sections of the central nervous system in the decapod crustacean, Penaeus monodon, by imaging mass spectrometry#Peptides 2012 Mar;34(1):10-8 | |
| NP00753 | NSELINSLLGIPKVMNDA |
18 | Penaeus monodon | Arthropod PDH | Pigment-dispersing hormone | 21459120#Chansela P, Goto-Inoue N, Zaima N, Sroyraya M, Sobhon P, Setou M#Visualization of neuropeptides in paraffin-embedded tissue sections of the central nervous system in the decapod crustacean, Penaeus monodon, by imaging mass spectrometry#Peptides 2012 Mar;34(1):10-8 | |
| NP00754 | NSELINSLLGIPKVMTDA |
18 | Penaeus monodon | Arthropod PDH | Pigment-dispersing hormone | 21459120#Chansela P, Goto-Inoue N, Zaima N, Sroyraya M, Sobhon P, Setou M#Visualization of neuropeptides in paraffin-embedded tissue sections of the central nervous system in the decapod crustacean, Penaeus monodon, by imaging mass spectrometry#Peptides 2012 Mar;34(1):10-8 | |
| NP00755 | RSIAVVVL |
8 | Penaeus monodon | Arthropod PDH | Pigment-dispersing hormone | 21459120#Chansela P, Goto-Inoue N, Zaima N, Sroyraya M, Sobhon P, Setou M#Visualization of neuropeptides in paraffin-embedded tissue sections of the central nervous system in the decapod crustacean, Penaeus monodon, by imaging mass spectrometry#Peptides 2012 Mar;34(1):10-8 | |
| NP00756 | RVAQGPSAFVAGPH |
14 | Penaeus monodon | Arthropod PDH | Pigment-dispersing hormone | 21459120#Chansela P, Goto-Inoue N, Zaima N, Sroyraya M, Sobhon P, Setou M#Visualization of neuropeptides in paraffin-embedded tissue sections of the central nervous system in the decapod crustacean, Penaeus monodon, by imaging mass spectrometry#Peptides 2012 Mar;34(1):10-8 | |
| NP00757 | VAQGPSAFVAG |
11 | Penaeus monodon | Arthropod PDH | Pigment-dispersing hormone | 21459120#Chansela P, Goto-Inoue N, Zaima N, Sroyraya M, Sobhon P, Setou M#Visualization of neuropeptides in paraffin-embedded tissue sections of the central nervous system in the decapod crustacean, Penaeus monodon, by imaging mass spectrometry#Peptides 2012 Mar;34(1):10-8 | |
| NP01558 | GYRKPPFNGS |
10 | Penaeus monodon | FMRFamide related peptide | SIFamide | 21459120#Chansela P, Goto-Inoue N, Zaima N, Sroyraya M, Sobhon P, Setou M#Visualization of neuropeptides in paraffin-embedded tissue sections of the central nervous system in the decapod crustacean, Penaeus monodon, by imaging mass spectrometry#Peptides 2012 Mar;34(1):10-8 | |
| NP01559 | RKPPFNGSIF |
10 | Penaeus monodon | FMRFamide related peptide | SIFamide | 21459120#Chansela P, Goto-Inoue N, Zaima N, Sroyraya M, Sobhon P, Setou M#Visualization of neuropeptides in paraffin-embedded tissue sections of the central nervous system in the decapod crustacean, Penaeus monodon, by imaging mass spectrometry#Peptides 2012 Mar;34(1):10-8 | |
| NP01901 | GDRNFLRF |
8 | Penaeus monodon | FMRFamide related peptide | FMRFamide-like neuropeptide FLP1 | 11959015#Sithigorngul P., Pupuem J., Krungkasem C., Longyant S., Chaivisuthangkura P., Sithigorngul W., Petsom A.; #Seven novel FMRFamide-like neuropeptide sequences from the eyestalk of the giant tiger prawn Penaeus monodon.; #Comp. Biochem. Physiol. 131B:325-337(2002). | |
| NP01902 | AYSNLNYLRF |
10 | Penaeus monodon | FMRFamide related peptide | FMRFamide-like neuropeptide FLP2 | 11959015#Sithigorngul P., Pupuem J., Krungkasem C., Longyant S., Chaivisuthangkura P., Sithigorngul W., Petsom A.; #Seven novel FMRFamide-like neuropeptide sequences from the eyestalk of the giant tiger prawn Penaeus monodon.; #Comp. Biochem. Physiol. 131B:325-337(2002). | |
| NP01903 | AQPSMRLRF |
9 | Penaeus monodon | FMRFamide related peptide | FMRFamide-like neuropeptide FLP3 | 11959015#Sithigorngul P., Pupuem J., Krungkasem C., Longyant S., Chaivisuthangkura P., Sithigorngul W., Petsom A.; #Seven novel FMRFamide-like neuropeptide sequences from the eyestalk of the giant tiger prawn Penaeus monodon.; #Comp. Biochem. Physiol. 131B:325-337(2002). | |
| NP01904 | SQPSMRLRF |
9 | Penaeus monodon | FMRFamide related peptide | FMRFamide-like neuropeptide FLP4 | 11959015#Sithigorngul P., Pupuem J., Krungkasem C., Longyant S., Chaivisuthangkura P., Sithigorngul W., Petsom A.; #Seven novel FMRFamide-like neuropeptide sequences from the eyestalk of the giant tiger prawn Penaeus monodon.; #Comp. Biochem. Physiol. 131B:325-337(2002). | |
| NP01905 | SMPSLRLRF |
9 | Penaeus monodon | FMRFamide related peptide | FMRFamide-like neuropeptide FLP5 | 11959015#Sithigorngul P., Pupuem J., Krungkasem C., Longyant S., Chaivisuthangkura P., Sithigorngul W., Petsom A.; #Seven novel FMRFamide-like neuropeptide sequences from the eyestalk of the giant tiger prawn Penaeus monodon.; #Comp. Biochem. Physiol. 131B:325-337(2002). | |
| NP01906 | DGRTPALRLRF |
11 | Penaeus monodon | FMRFamide related peptide | FMRFamide-like neuropeptide FLP6 | 11959015#Sithigorngul P., Pupuem J., Krungkasem C., Longyant S., Chaivisuthangkura P., Sithigorngul W., Petsom A.; #Seven novel FMRFamide-like neuropeptide sequences from the eyestalk of the giant tiger prawn Penaeus monodon.; #Comp. Biochem. Physiol. 131B:325-337(2002). | |
| NP01907 | GYRKPPFNGSIF |
12 | Penaeus monodon | FMRFamide related peptide | SIFamide | 11959015#Sithigorngul P., Pupuem J., Krungkasem C., Longyant S., Chaivisuthangkura P., Sithigorngul W., Petsom A.; #Seven novel FMRFamide-like neuropeptide sequences from the eyestalk of the giant tiger prawn Penaeus monodon.; #Comp. Biochem. Physiol. 131B:325-337(2002). | |
| NP02069 | QFDEYGHMRF |
10 | Penaeus monodon | Gastrin/cholecystokinin | Sulfakinin-1 | 10672025#Johnsen AH, Duve H, Davey M, Hall M, Thorpe A#Sulfakinin neuropeptides in a crustacean#Isolation, identification andtissue localization in the tiger prawn Penaeus monodon Eur J Biochem 2000 Feb;267(4):1153-60 | |
| NP02070 | AGGSGGVGGEYDDYGHLRF |
19 | Penaeus monodon | Gastrin/cholecystokinin | Sulfakinin-2 | 10672025#Johnsen AH, Duve H, Davey M, Hall M, Thorpe A#Sulfakinin neuropeptides in a crustacean#Isolation, identification andtissue localization in the tiger prawn Penaeus monodon Eur J Biochem 2000 Feb;267(4):1153-60 | |
| NP02071 | VGGEYDDYGHLRF |
13 | Penaeus monodon | Gastrin/cholecystokinin | Sulfakinin-3 | 10672025#Johnsen AH, Duve H, Davey M, Hall M, Thorpe A#Sulfakinin neuropeptides in a crustacean#Isolation, identification andtissue localization in the tiger prawn Penaeus monodon Eur J Biochem 2000 Feb;267(4):1153-60 | |
| NP03910 | RARPRF |
6 | Penaeus monodon | NPY | Peptide tyrosine phenylalanine 1 | 12431727#Sithigorngul P., Pupuem J., Krungkasem C., Longyant S., Panchan N., Chaivisuthangkura P., Sithigorngul W., Petsom A.; #Four novel PYFs: members of NPY/PP peptide superfamily from the eyestalk of the giant tiger prawn Penaeus monodon.; #Peptides 23:1895-1906(2002). | |
| NP03911 | YSQVSRPRF |
9 | Penaeus monodon | NPY | Peptide tyrosine phenylalanine 2 | 12431727#Sithigorngul P., Pupuem J., Krungkasem C., Longyant S., Panchan N., Chaivisuthangkura P., Sithigorngul W., Petsom A.; #Four novel PYFs: members of NPY/PP peptide superfamily from the eyestalk of the giant tiger prawn Penaeus monodon.; #Peptides 23:1895-1906(2002). | |
| NP03912 | YAIAGRPRF |
9 | Penaeus monodon | NPY | Peptide tyrosine phenylalanine 3 | 12431727#Sithigorngul P., Pupuem J., Krungkasem C., Longyant S., Panchan N., Chaivisuthangkura P., Sithigorngul W., Petsom A.; #Four novel PYFs: members of NPY/PP peptide superfamily from the eyestalk of the giant tiger prawn Penaeus monodon.; #Peptides 23:1895-1906(2002). | |
| NP03913 | YSLRARPRF |
9 | Penaeus monodon | NPY | Peptide tyrosine phenylalanine 4 | 12431727#Sithigorngul P., Pupuem J., Krungkasem C., Longyant S., Panchan N., Chaivisuthangkura P., Sithigorngul W., Petsom A.; #Four novel PYFs: members of NPY/PP peptide superfamily from the eyestalk of the giant tiger prawn Penaeus monodon.; #Peptides 23:1895-1906(2002). | |
| NP04373 | NFDEIDR |
7 | Penaeus monodon | Orcokinin | Orcokinin | 21459120#Chansela P, Goto-Inoue N, Zaima N, Sroyraya M, Sobhon P, Setou M#Visualization of neuropeptides in paraffin-embedded tissue sections of the central nervous system in the decapod crustacean, Penaeus monodon, by imaging mass spectrometry#Peptides 2012 Mar;34(1):10-8 | |
| NP04374 | NFDEIDRSGFDG |
12 | Penaeus monodon | Orcokinin | Orcokinin | 21459120#Chansela P, Goto-Inoue N, Zaima N, Sroyraya M, Sobhon P, Setou M#Visualization of neuropeptides in paraffin-embedded tissue sections of the central nervous system in the decapod crustacean, Penaeus monodon, by imaging mass spectrometry#Peptides 2012 Mar;34(1):10-8 | |
| NP04375 | NFDEIDRSGFGFV |
13 | Penaeus monodon | Orcokinin | Orcokinin | 21459120#Chansela P, Goto-Inoue N, Zaima N, Sroyraya M, Sobhon P, Setou M#Visualization of neuropeptides in paraffin-embedded tissue sections of the central nervous system in the decapod crustacean, Penaeus monodon, by imaging mass spectrometry#Peptides 2012 Mar;34(1):10-8 | |
| NP04376 | FDAFTTGFGHS |
11 | Penaeus monodon | Orcokinin | Orcokinin-related peptide | 21459120#Chansela P, Goto-Inoue N, Zaima N, Sroyraya M, Sobhon P, Setou M#Visualization of neuropeptides in paraffin-embedded tissue sections of the central nervous system in the decapod crustacean, Penaeus monodon, by imaging mass spectrometry#Peptides 2012 Mar;34(1):10-8 | |
| NP04377 | FTTGFGHS |
8 | Penaeus monodon | Orcokinin | Orcokinin-related peptide | 21459120#Chansela P, Goto-Inoue N, Zaima N, Sroyraya M, Sobhon P, Setou M#Visualization of neuropeptides in paraffin-embedded tissue sections of the central nervous system in the decapod crustacean, Penaeus monodon, by imaging mass spectrometry#Peptides 2012 Mar;34(1):10-8 | |
| NP05598 | APSGFLGMR |
9 | Penaeus monodon | Tachykinin | Tachykinin-related peptide | 21459120#Chansela P, Goto-Inoue N, Zaima N, Sroyraya M, Sobhon P, Setou M#Visualization of neuropeptides in paraffin-embedded tissue sections of the central nervous system in the decapod crustacean, Penaeus monodon, by imaging mass spectrometry#Peptides 2012 Mar;34(1):10-8 | |
| NP05599 | APSGFQGMR |
9 | Penaeus monodon | Tachykinin | Tachykinin-related peptide | 21459120#Chansela P, Goto-Inoue N, Zaima N, Sroyraya M, Sobhon P, Setou M#Visualization of neuropeptides in paraffin-embedded tissue sections of the central nervous system in the decapod crustacean, Penaeus monodon, by imaging mass spectrometry#Peptides 2012 Mar;34(1):10-8 | |
| NP05600 | PSGFLGMR |
8 | Penaeus monodon | Tachykinin | Tachykinin-related peptide | 21459120#Chansela P, Goto-Inoue N, Zaima N, Sroyraya M, Sobhon P, Setou M#Visualization of neuropeptides in paraffin-embedded tissue sections of the central nervous system in the decapod crustacean, Penaeus monodon, by imaging mass spectrometry#Peptides 2012 Mar;34(1):10-8 |