Total number of results for GnRH are 74
Download
as Fasta All
| NPID | Sequence | Length | Organism | Family | Name | PMID | Peptide_REF |
|---|---|---|---|---|---|---|---|
| NP02516 |
EHWSYGLQPG
|
10 | Alligator mississippiensis | GnRH | GnRH I | 1882082#Lovejoy DA, Fischer WH, Parker DB, McRory JE, Park M, Lance V, Swanson P, Rivier JE, Sherwood NM#Primary structure of two forms of gonadotropin-releasing hormone from brains of the American alligator (Alligator mississippiensis)#Regul Pept 1991 Apr 25;33(2):105-16 | |
| NP02517 |
EHWSHGWYPG
|
10 | Alligator mississippiensis | GnRH | GnRH II | 1882082#Lovejoy DA, Fischer WH, Parker DB, McRory JE, Park M, Lance V, Swanson P, Rivier JE, Sherwood NM#Primary structure of two forms of gonadotropin-releasing hormone from brains of the American alligator (Alligator mississippiensis)#Regul Pept 1991 Apr 25;33(2):105-16 | |
| NP02518 |
QNYHFSNGWYAG
|
12 | Aplysia californica | GnRH | GnRH | 18178211#Zhang L, Tello JA, Zhang W, Tsai PS#Molecular cloning, expression pattern, and immunocytochemical localization of a gonadotropin-releasing hormone-like molecule in the gastropod mollusk, Aplysia californica#Gen Comp Endocrinol 2008 Apr 1;156(2):201-9 | |
| NP02519 |
EHWSYGLRPG
|
10 | Branchiostoma lanceolatum | GnRH | GnRH | 18927217#Chambery A, Parente A, Topo E, Garcia-Fernàndez J, D'Aniello S#Characterization and putative role of a type I gonadotropin-releasing hormone in the cephalochordate amphioxus#Endocrinology 2009 Feb;150(2):812-20 | |
| NP02520 |
EHWSDYFKPG
|
10 | Chelyosoma productum | GnRH | GnRH-I | 8816823#Powell JF, Reska-Skinner SM, Prakash MO, Fischer WH, Park M, Rivier JE, Craig AG, Mackie GO, Sherwood NM#Two new forms of gonadotropin-releasing hormone in a protochordate and the evolutionary implications#Proc Natl Acad Sci U S A 1996 Sep 17;93(19):10461-4 | |
| NP02521 |
EHWSLCHAPG
|
10 | Chelyosoma productum | GnRH | GnRH-II | 8816823#Powell JF, Reska-Skinner SM, Prakash MO, Fischer WH, Park M, Rivier JE, Craig AG, Mackie GO, Sherwood NM#Two new forms of gonadotropin-releasing hormone in a protochordate and the evolutionary implications#Proc Natl Acad Sci U S A 1996 Sep 17;93(19):10461-4 | |
| NP02522 |
EHWSHGLNPG
|
10 | Clarias gariepinus | GnRH | GnRH I | 1520292#Bogerd J, Li KW, Janssen-Dommerholt C, Goos H#Two gonadotropin-releasing hormones from African catfish (Clarias gariepinus)#Biochem Biophys Res Commun 1992 Aug 31;187(1):127-34 | |
| NP02523 |
EHWSHGWYPG
|
10 | Clarias gariepinus | GnRH | GnRH II | 1520292#Bogerd J, Li KW, Janssen-Dommerholt C, Goos H#Two gonadotropin-releasing hormones from African catfish (Clarias gariepinus)#Biochem Biophys Res Commun 1992 Aug 31;187(1):127-34 | |
| NP02524 |
EHWSHGLSPG
|
10 | Clupea pallasii | GnRH | GnRH | 10650929#Carolsfeld J, Powell JF, Park M, Fischer WH, Craig AG, Chang JP, Rivier JE, Sherwood NM#Primary structure and function of three gonadotropin-releasing hormones, including a novel form, from an ancient teleost, herring#Endocrinology 2000 Feb;141(2):505-12 | |
| NP02525 |
EHWSYGMNPG
|
10 | Coregonus clupeaformis | GnRH | GnRH | 12080022#Adams BA, Vickers ED, Warby C, Park M, Fischer WH, Grey Craig A, Rivier JE, Sherwood NM#Three forms of gonadotropin-releasing hormone, including a novel form, in a basal salmonid, Coregonus clupeaformis#Biol Reprod 2002 Jul;67(1):232-9 | |
| NP02526 |
EHWSHGWYP
|
9 | Gallus gallus | GnRH | LHRH-II | 3518873#Sharp PJ, Sterling RJ, Milton RC, Millar RP#Effect of luteinising hormone releasing hormone and its analogues on plasma luteinising hormone concentrations in incubating bantam hens#Br Poult Sci 1986 Mar;27(1):129-35 | |
| NP02527 |
EHWSHGWYPG
|
10 | Hydrolagus colliei | GnRH | GnRH | 1678723#Lovejoy DA, Sherwood NM, Fischer WH, Jackson BC, Rivier JE, Lee T#Primary structure of gonadotropin-releasing hormone from the brain of a holocephalan (ratfish: Hydrolagus colliei)#Gen Comp Endocrinol 1991 Apr;82(1):152-61 | |
| NP02528 |
CHWSYGLRPG
|
10 | NA | GnRH | GnRH | 16483697#Earl ER, Waterston MM, Aughey E, Harvey MJ, Matschke C, Colston A, Ferro VA#Evaluation of two GnRH-I based vaccine formulations on the testes function of entire Suffolk cross ram lambs#Vaccine 2006 Apr 12;24(16):3172-83 | |
| NP02529 |
EHSYGLSPG
|
9 | NA | GnRH | GnRH | 9100286#Powell JF, Standen EM, Carolsfeld J, Borella MI, Gazola R, Fischer WH, Park M, Craig AG, Warby CM, Rivier JE, Val-Sella MV, Sherwood NM#Primary structure of three forms of gonadotropin-releasing hormone (GnRH) from the pacu brain#Regul Pept 1997 Feb 26;68(3):189-95 | |
| NP02530 |
EHWSHGWLPG
|
10 | NA | GnRH | GnRH | 1631133#Lovejoy DA, Fischer WH, Ngamvongchon S, Craig AG, Nahorniak CS, Peter RE, Rivier JE, Sherwood NM#Distinct sequence of gonadotropin-releasing hormone (GnRH) in dogfish brain provides insight into GnRH evolution#Proc Natl Acad Sci U S A 1992 Jul 15;89(14):6373-7 | |
| NP02531 |
EHYSLEWKPG
|
10 | NA | GnRH | GnRH | 3514603#Sherwood NM, Sower SA, Marshak DR, Fraser BA, Brownstein MJ#Primary structure of gonadotropin-releasing hormone from lamprey brain#J Biol Chem 1986 Apr 15;261(11):4812-9 | |
| NP02532 |
EHSHGWYPG
|
9 | NA | GnRH | GnRH II | 11493674#Millar R, Lowe S, Conklin D, Pawson A, Maudsley S, Troskie B, Ott T, Millar M, Lincoln G, Sellar R, Faurholm B, Scobie G, Kuestner R, Terasawa E, Katz A#A novel mammalian receptor for the evolutionarily conserved type II GnRH#Proc Natl Acad Sci U S A 2001 Aug 14;98(17):9636-41 | |
| NP02533 |
EHWSGLRPG
|
9 | NA | GnRH | GnRH II | 16179411#Barnett DK, Bunnell TM, Millar RP, Abbott DH#Gonadotropin-releasing hormone II stimulates female sexual behavior in marmoset monkeys#Endocrinology 2006 Jan;147(1):615-23 | |
| NP02534 |
QHWSHGWFPG
|
10 | NA | GnRH | GnRH-II | 18436713#Kavanaugh SI, Nozaki M, Sower SA#Origins of gonadotropin-releasing hormone (GnRH) in vertebrates: identification of a novel GnRH in a basal vertebrate, the sea lamprey#Endocrinology 2008 Aug;149(8):3860-9 | |
| NP02535 |
EHWSFGLSPG
|
10 | Odontesthes bonariensis | GnRH | GnRH | 11250925#Montaner AD, Park MK, Fischer WH, Craig AG, Chang JP, Somoza GM, Rivier JE, Sherwood NM#Primary structure of a novel gonadotropin-releasing hormone in the brain of a teleost, Pejerrey#Endocrinology 2001 Apr;142(4):1453-60 | |
| NP02536 |
EHWSYGWLPG
|
10 | Oncorhynchus sp. | GnRH | GnRH | 9100286#Powell JF, Standen EM, Carolsfeld J, Borella MI, Gazola R, Fischer WH, Park M, Craig AG, Warby CM, Rivier JE, Val-Sella MV, Sherwood NM#Primary structure of three forms of gonadotropin-releasing hormone (GnRH) from the pacu brain#Regul Pept 1997 Feb 26;68(3):189-95 | |
| NP02537 |
HWSHDWKPG
|
9 | Petromyzon marinus | GnRH | GnRH-III | 17254668#Mezo G, Czajlik A, Manea M, Jakab A, Farkas V, Majer Z, Vass E, Bodor A, Kapuvári B, Boldizsár M, Vincze B, Csuka O, Kovács M, Przybylski M, Perczel A, Hudecz F#Structure, enzymatic stability and antitumor activity of sea lamprey GnRH-III and its dimer derivatives#Peptides 2007 Apr;28(4):806-20 | |
| NP02538 |
EHWSHGWYPG
|
10 | Sparus aurata | GnRH | GnRH | 7991588#Powell JF, Zohar Y, Elizur A, Park M, Fischer WH, Craig AG, Rivier JE, Lovejoy DA, Sherwood NM#Three forms of gonadotropin-releasing hormone characterized from brains of one species#Proc Natl Acad Sci U S A 1994 Dec 6;91(25):12081-5 | |
| NP02539 |
EHWSYGLSPG
|
10 | Sparus aurata | GnRH | GnRH | 7991588#Powell JF, Zohar Y, Elizur A, Park M, Fischer WH, Craig AG, Rivier JE, Lovejoy DA, Sherwood NM#Three forms of gonadotropin-releasing hormone characterized from brains of one species#Proc Natl Acad Sci U S A 1994 Dec 6;91(25):12081-5 | |
| NP02540 |
QHWSKGYSPG
|
10 | Ciona intestinalis | GnRH | t-GnRH-3 | 21467196#Kawada T, Ogasawara M, Sekiguchi T, Aoyama M, Hotta K, Oka K, Satake H#Peptidomic analysis of the central nervous system of the protochordate, Ciona intestinalis: homologs and prototypes of vertebrate peptides and novel peptides#Endocrinology 2011 Jun;152(6):2416-27 | |
| NP02541 |
QHWSYEFMPG
|
10 | Ciona intestinalis | GnRH | t-GnRH-5 | 21467196#Kawada T, Ogasawara M, Sekiguchi T, Aoyama M, Hotta K, Oka K, Satake H#Peptidomic analysis of the central nervous system of the protochordate, Ciona intestinalis: homologs and prototypes of vertebrate peptides and novel peptides#Endocrinology 2011 Jun;152(6):2416-27 | |
| NP02542 |
DPLTNIM
|
7 | Ciona intestinalis | GnRH | t-GnRH-6 | 21467196#Kawada T, Ogasawara M, Sekiguchi T, Aoyama M, Hotta K, Oka K, Satake H#Peptidomic analysis of the central nervous system of the protochordate, Ciona intestinalis: homologs and prototypes of vertebrate peptides and novel peptides#Endocrinology 2011 Jun;152(6):2416-27 | |
| NP02543 |
GEKESRPLSSYPGSV
|
15 | Ciona intestinalis | GnRH | t-GnRH-6 | 21467196#Kawada T, Ogasawara M, Sekiguchi T, Aoyama M, Hotta K, Oka K, Satake H#Peptidomic analysis of the central nervous system of the protochordate, Ciona intestinalis: homologs and prototypes of vertebrate peptides and novel peptides#Endocrinology 2011 Jun;152(6):2416-27 | |
| NP02544 |
QHWSYEYMPG
|
10 | Ciona intestinalis | GnRH | t-GnRH-6 | 21467196#Kawada T, Ogasawara M, Sekiguchi T, Aoyama M, Hotta K, Oka K, Satake H#Peptidomic analysis of the central nervous system of the protochordate, Ciona intestinalis: homologs and prototypes of vertebrate peptides and novel peptides#Endocrinology 2011 Jun;152(6):2416-27 | |
| NP02545 |
WLRYDA
|
6 | Ciona intestinalis | GnRH | t-GnRH-6 | 21467196#Kawada T, Ogasawara M, Sekiguchi T, Aoyama M, Hotta K, Oka K, Satake H#Peptidomic analysis of the central nervous system of the protochordate, Ciona intestinalis: homologs and prototypes of vertebrate peptides and novel peptides#Endocrinology 2011 Jun;152(6):2416-27 | |
| NP02546 |
HWSYGLRPG
|
9 | Rattus norvegicus | GnRH | LHRH | 12716136#Svensson M, Sköld K, Svenningsson P, Andren PE#Peptidomics-based discovery of novel neuropeptides#J Proteome Res 2003 Mar-Apr;2(2):213-9 | |
| NP02547 |
QHWSNWWIPGAPGYNG
|
16 | Ciona intestinalis | GnRH | Ci-GnRH-X | 21467196#Kawada T, Ogasawara M, Sekiguchi T, Aoyama M, Hotta K, Oka K, Satake H#Peptidomic analysis of the central nervous system of the protochordate, Ciona intestinalis: homologs and prototypes of vertebrate peptides and novel peptides#Endocrinology 2011 Jun;152(6):2416-27 | |
| NP02548 |
QYWSYGVRPGGKRNIEPLVDSFQEMAKEIDQLAEPQHFECTLHQPRSPLRDLKGALESLMEEETGQKKI
|
69 | Cavia porcellus | GnRH | Progonadoliberin-1 | ||
| NP02549 |
QYWSYGVRPG
|
10 | Cavia porcellus | GnRH | Gonadoliberin-1 | ||
| NP02550 |
NIEPLVDSFQEMAKEIDQLAEPQHFECTLHQPRSPLRDLKGALESLMEEETGQKKI
|
56 | Cavia porcellus | GnRH | GnRH-associated peptide 1 | ||
| NP02551 |
QHWSYGLQPGGKRNAENLVESFQEIANEMESLGEGQKAECPGSYQHPRLSDLKETMASLIEGEARRKEI
|
69 | Gallus gallus | GnRH | Progonadoliberin-1 | ||
| NP02552 |
QHWSYGLQPG
|
10 | Gallus gallus | GnRH | Gonadoliberin-1 | 7050119#King J.A., Millar R.P.#Structure of chicken hypothalamic luteinizing hormone-releasing hormone. II. Isolation and characterization.# J. Biol. Chem. 257:10729-10732(1982).$#King J.A., Millar R.P.#Structure of avian hypothalamic gonadotrophin-releasing hormone.#S. Afr. J. Sci. 78:124-125(1982). | |
| NP02553 |
NAENLVESFQEIANEMESLGEGQKAECPGSYQHPRLSDLKETMASLIEGEARRKEI
|
56 | Gallus gallus | GnRH | GnRH-associated peptide 1 | ||
| NP02554 |
QHWSYGLRPGGKRNAERLGDSFQEMDKEVDQLAEPQHLECTVHWPRSPLRDLRGVLESLIEEE
|
63 | Mesocricetus auratus | GnRH | Progonadoliberin-1 | ||
| NP02555 |
QHWSYGLRPG
|
10 | Mesocricetus auratus | GnRH | Gonadoliberin-1 | ||
| NP02556 |
NAERLGDSFQEMDKEVDQLAEPQHLECTVHWPRSPLRDLRGVLESLIEEE
|
50 | Mesocricetus auratus | GnRH | GnRH-associated peptide 1 (By similarity) | ||
| NP02557 |
QHWSYGLRPGGKRNAKNVIDSFQEIAKEVDQPVEPKCCGCIVHQSHSPLRDLKAALESLIE
|
61 | Ovis aries | GnRH | Progonadoliberin-1 | ||
| NP02558 |
QHWSYGLRPG
|
10 | Ovis aries | GnRH | Gonadoliberin-1 | 4550508#Burgus R., Butcher M., Amoss M., Ling N., Monahan M., Rivier J., Fellows R., Blackwell R., Vale W., Guillemin R.#Primary structure of the ovine hypothalamic luteinizing hormone- releasing factor (LRF) (LH-hypothalamus-LRF-gas chromatography-mass spectrometry-decapeptide-Edman degradation).# Proc. Natl. Acad. Sci. U.S.A. 69:278-282(1972). | |
| NP02559 |
NAKNVIDSFQEIAKEVDQPVEPKCCGCIVHQSHSPLRDLKAALESLIE
|
48 | Ovis aries | GnRH | GnRH-associated peptide 1 | ||
| NP02560 |
QHWSHGWYPGGKRSPDSPQDPQPAPRFPEGYWLGLAAGNPRQSTQSLPSKALAPPEDTVSEEAKTMAWWHLQKQRLIQTLLPRP
|
84 | Suncus murinus | GnRH | Progonadoliberin-2 | ||
| NP02561 |
QHWSHGWYPG
|
10 | Suncus murinus | GnRH | Gonadoliberin-2 | ||
| NP02562 |
SPDSPQDPQPAPRFPEGYWLGLAAGNPRQSTQSLPSKALAPPEDTVSEEAKTMAWWHLQKQRLIQTLLPRP
|
71 | Suncus murinus | GnRH | GnRH-associated peptide 2 | ||
| NP02563 |
QHWSYGLRPGGKRNAENVIDSFQEMAKEVARLAEPQRFECTAHQPRSPLRDLKGALESLIEEETGQKT
|
68 | Sus scrofa | GnRH | Progonadoliberin-1 | ||
| NP02564 |
QHWSYGLRPG
|
10 | Sus scrofa | GnRH | Gonadoliberin-1 | 4946067#Baba Y., Matsuo H., Schally A.V.#Structure of the porcine LH- and FSH-releasing hormone. II. Confirmation of the proposed structure by conventional sequential analyses.# Biochem. Biophys. Res. Commun. 44:459-463(1971). | |
| NP02565 |
GKRNAENVIDSFQEMAKEVARLAEPQRFECTAHQPRSPLRDLKGALESLIEEETGQKT
|
58 | Sus scrofa | GnRH | GnRH-associated peptide 1 | ||
| NP02566 |
QHWSYGLRPGGKRNAENLIDSFQEIAKEADQLAEPQHFECTISQPRSPLRALKGALESLIEEETGQKKI
|
69 | Tupaia belangeri | GnRH | Progonadoliberin-1 | ||
| NP02567 |
QHWSYGLRPG
|
10 | Tupaia belangeri | GnRH | Gonadoliberin-1 | ||
| NP02568 |
NAENLIDSFQEIAKEADQLAEPQHFECTISQPRSPLRALKGALESLIEEETGQKKI
|
56 | Tupaia belangeri | GnRH | GnRH-associated peptide 1 | ||
| NP02569 |
QHWSHGWYPGGKRASNSPQDPQSALRPPAPSAAQTAHSFRSAALASPEDSVPWEGRTTAGWSLRRKQHLMRTLLSAAGAPRPAAVPIKP
|
89 | Tupaia belangeri | GnRH | Progonadoliberin-2 | ||
| NP02570 |
QHWSHGWYPG
|
10 | Tupaia belangeri | GnRH | Gonadoliberin-2 | ||
| NP02571 |
ASNSPQDPQSALRPPAPSAAQTAHSFRSAALASPEDSVPWEGRTTAGWSLRRKQHLMRTLLSAAGAPRPAAVPIKP
|
76 | Tupaia belangeri | GnRH | GnRH-associated peptide 2 | ||
| NP02572 |
DAENLIDSFQEIVKEVGQLAETQRFECTTHQPRSPLRDLKGALESLIEEETGQKKI
|
56 | Homo sapiens | GnRH | GnRH-associated peptide 1 | ||
| NP02573 |
QHWSYGLRPG
|
10 | Homo sapiens | GnRH | Gonadoliberin-1 | 6760865# Tan L., Rousseau P.; # "The chemical identity of the immunoreactive LHRH-like peptide biosynthesized in the human placenta."; # Biochem. Biophys. Res. Commun. 109:1061-1071(1982). | |
| NP02574 |
QHWSYGLRPGGKRDAENLIDSFQEIVKEVGQLAETQRFECTTHQPRSPLRDLKGALESLIEEETGQKKI
|
69 | Homo sapiens | GnRH | Progonadoliberin-1 | ||
| NP02575 |
ALSSAQDPQNALRPPGRALDTAAGSPVQTAHGLPSDALAPLDDSMPWEGRTTAQWSLHRKRHLARTLLTAAREPRPAPPSSNKV
|
84 | Homo sapiens | GnRH | GnRH-associated peptide 2 | ||
| NP02576 |
QHWSHGWYPG
|
10 | Homo sapiens | GnRH | Gonadoliberin-2 | 9419371#White RB, Eisen JA, Kasten TL, Fernald RD#Second gene for gonadotropin-releasing hormone in humans#Proc Natl Acad Sci U S A 1998 Jan 6;95(1):305-9 | |
| NP02577 |
QHWSHGWYPGGKRALSSAQDPQNALRPPGRALDTAAGSPVQTAHGLPSDALAPLDDSMPWEGRTTAQWSLHRKRHLARTLLTAAREPRPAPPSSNKV
|
97 | Homo sapiens | GnRH | Progonadoliberin-2 | ||
| NP02578 |
DAENLMDSFQEIVKEVGQLAETQHFECTMHQPRSPLQDLKGALESLIEE
|
49 | Macaca mulatta | GnRH | GnRH-associated peptide 1 | ||
| NP02579 |
QHWSYGLRPG
|
10 | Macaca mulatta | GnRH | Gonadoliberin-1 | ||
| NP02580 |
QHWSYGLRPGGKRDAENLMDSFQEIVKEVGQLAETQHFECTMHQPRSPLQDLKGALESLIEE
|
62 | Macaca mulatta | GnRH | Progonadoliberin-1 | ||
| NP02581 |
ALSSAQDPQNALRPPAGSPAQATYGLPSDALAHLEDSMPWEGRTMAWWSLRRKRYLAQTLLTAAREPRPVPPSSNKV
|
77 | Macaca mulatta | GnRH | GnRH-associated peptide 2 | ||
| NP02582 |
QHWSHGWYPG
|
10 | Macaca mulatta | GnRH | Gonadoliberin-2 | ||
| NP02583 |
QHWSHGWYPGGKRALSSAQDPQNALRPPAGSPAQATYGLPSDALAHLEDSMPWEGRTMAWWSLRRKRYLAQTLLTAAREPRPVPPSSNKV
|
90 | Macaca mulatta | GnRH | Progonadoliberin-2 | ||
| NP02584 |
QHWSYGLRPG
|
10 | Mus musculus | GnRH | Gonadoliberin-1 | ||
| NP02585 |
QHWSYGLRPGGKRNTEHLVESFQEMGKEVDQMAEPQHFECTVHWPRSPLRDLRGALESLIEEEARQKKM
|
69 | Mus musculus | GnRH | Progonadoliberin-1 | ||
| NP02586 |
NTEHLVESFQEMGKEVDQMAEPQHFECTVHWPRSPLRDLRGALESLIEEEARQKKM
|
56 | Mus musculus | GnRH | Prolactin release-inhibiting factor 1 | ||
| NP02587 |
QHWSYGLRPG
|
10 | Rattus norvegicus | GnRH | Gonadoliberin-1 | ||
| NP02588 |
QHWSYGLRPGGKRNTEHLVDSFQEMGKEEDQMAEPQNFECTVHWPRSPLRDLRGALERLIEEEAGQKKM
|
69 | Rattus norvegicus | GnRH | Progonadoliberin-1 | ||
| NP02589 |
NTEHLVDSFQEMGKEEDQMAEPQNFECTVHWPRSPLRDLRGALERLIEEEAGQKKM
|
56 | Rattus norvegicus | GnRH | Prolactin release-inhibiting factor 1 |