Total number of results for Arthropod PDH are 37
Download
as Fasta All
| NPID | Sequence | Length | Organism | Family | Name | PMID | Peptide_REF |
|---|---|---|---|---|---|---|---|
| NP00730 | NSEIINSLLGLPKVLNDA |
18 | Gryllus bimaculatus | Arthropod PDH | Pigment-dispersing factor | 14624032#Singaravel M, Fujisawa Y, Hisada M, Saifullah AS, Tomioka K#Phase shifts of the circadian locomotor rhythm induced by pigment-dispersing factor in the cricket Gryllus bimaculatus#Zoolog Sci 2003 Nov;20(11):1347-54 | |
| NP00731 | NSGMINSILGIPRVMTEA |
18 | NA | Arthropod PDH | pigment-dispersing crustacean neurohormone | 6897116#Riehm JP, Rao KR#Structure-activity relationships of a pigment-dispersing crustacean neurohormone#Peptides 1982 Jul-Aug;3(4):643-7 | |
| NP00732 | NSELINSLLSLPKKLNDA |
18 | Aedes aegypti | Arthropod PDH | Pigment-dispersing hormone | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
| NP00733 | NSELINSLLGLPKNMNNA |
18 | Apis mellifera | Arthropod PDH | Pigment dispersing factor | 19576913#Boerjan B, Cardoen D, Bogaerts A, Landuyt B, Schoofs L, Verleyen P#Mass spectrometric profiling of (neuro)-peptides in the worker honeybee, Apis mellifera#Neuropharmacology 2010 Jan;58(1):248-58 | |
| NP00734 | QELHVPEREA |
10 | Callinectes sapidus | Arthropod PDH | Pigment-dispersing hormone | 21740068#Hui L, Cunningham R, Zhang Z, Cao W, Jia C, Li L#Discovery and characterization of the Crustacean hyperglycemic hormone precursor related peptides (CPRP) and orcokinin neuropeptides in the sinus glands of the blue crab Callinectes sapidus using multiple tandem mass spectrometry techniques#J Proteome Res 2011 Sep 2;10(9):4219-29 | |
| NP00735 | NSELINSILGLPKVMNDA |
18 | Cancer borealis | Arthropod PDH | β-PDH | 16214114#Fu Q, Goy MF, Li L#Identification of neuropeptides from the decapod crustacean sinus glands using nanoscale liquid chromatography tandem mass spectrometry#Biochem Biophys Res Commun 2005 Nov 25;337(3):765-78 | |
| NP00736 | NSELINSLLGISRLMNEA |
18 | Cancer borealis | Arthropod PDH | β-PDH | 16214114#Fu Q, Goy MF, Li L#Identification of neuropeptides from the decapod crustacean sinus glands using nanoscale liquid chromatography tandem mass spectrometry#Biochem Biophys Res Commun 2005 Nov 25;337(3):765-78 | |
| NP00737 | NSELINSLLGLPRFMKVV |
18 | Daphnia pulex | Arthropod PDH | Pigment dispersing hormone | 21830762#Dircksen H, Neupert S, Predel R, Verleyen P, Huybrechts J, Strauss J, Hauser F, Stafflinger E, Schneider M, Pauwels K, Schoofs L, Grimmelikhuijzen CJ#Genomics, transcriptomics, and peptidomics of Daphnia pulex neuropeptides and protein hormones#J Proteome Res 2011 Oct 7;10(10):4478-504 | |
| NP00738 | NSELINSILGLPKVMNDA |
18 | Homarus americanus | Arthropod PDH | β-PDH | 16214114#Fu Q, Goy MF, Li L#Identification of neuropeptides from the decapod crustacean sinus glands using nanoscale liquid chromatography tandem mass spectrometry#Biochem Biophys Res Commun 2005 Nov 25;337(3):765-78 | |
| NP00739 | NSELINSLLGISRLMNEA |
18 | Homarus americanus | Arthropod PDH | β-PDH | 16214114#Fu Q, Goy MF, Li L#Identification of neuropeptides from the decapod crustacean sinus glands using nanoscale liquid chromatography tandem mass spectrometry#Biochem Biophys Res Commun 2005 Nov 25;337(3):765-78 | |
| NP00740 | NSELINSLLSLPKNMNNA |
18 | Nasonia vitripennis | Arthropod PDH | Pigment dispersing factor | 20695486#Hauser F, Neupert S, Williamson M, Predel R, Tanaka Y, Grimmelikhuijzen CJ#Genomics and peptidomics of neuropeptides and protein hormones present in the parasitic wasp Nasonia vitripennis#J Proteome Res 2010 Oct 1;9(10):5296-310 | |
| NP00741 | NSELINSILGLPK |
13 | Ocypode ceratophthalma | Arthropod PDH | Pigment-dispersing hormone | 23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34 | |
| NP00742 | NSELINSILGLPKVM |
15 | Ocypode ceratophthalma | Arthropod PDH | Pigment-dispersing hormone | 23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34 | |
| NP00743 | NSELINSILGLPKVMNDA |
18 | Ocypode ceratophthalma | Arthropod PDH | Pigment-dispersing hormone | 23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34 | |
| NP00744 | SELINSILGLPKVMNDA |
17 | Ocypode ceratophthalma | Arthropod PDH | Pigment-dispersing hormone | 23298572#Hui L, D'Andrea BT, Jia C, Liang Z, Christie AE, Li L#Mass spectrometric characterization of the neuropeptidome of the ghost crab Ocypode ceratophthalma (Brachyura, Ocypodidae)#Gen Comp Endocrinol 2013 Apr 1;184:22-34 | |
| NP00745 | AAQILRVAQGPSAFVAGPH |
19 | Penaeus monodon | Arthropod PDH | Pigment-dispersing hormone | 21459120#Chansela P, Goto-Inoue N, Zaima N, Sroyraya M, Sobhon P, Setou M#Visualization of neuropeptides in paraffin-embedded tissue sections of the central nervous system in the decapod crustacean, Penaeus monodon, by imaging mass spectrometry#Peptides 2012 Mar;34(1):10-8 | |
| NP00746 | LINSILGLPK |
10 | Penaeus monodon | Arthropod PDH | Pigment-dispersing hormone | 21459120#Chansela P, Goto-Inoue N, Zaima N, Sroyraya M, Sobhon P, Setou M#Visualization of neuropeptides in paraffin-embedded tissue sections of the central nervous system in the decapod crustacean, Penaeus monodon, by imaging mass spectrometry#Peptides 2012 Mar;34(1):10-8 | |
| NP00747 | LINSLLGIPKVMNDA |
15 | Penaeus monodon | Arthropod PDH | Pigment-dispersing hormone | 21459120#Chansela P, Goto-Inoue N, Zaima N, Sroyraya M, Sobhon P, Setou M#Visualization of neuropeptides in paraffin-embedded tissue sections of the central nervous system in the decapod crustacean, Penaeus monodon, by imaging mass spectrometry#Peptides 2012 Mar;34(1):10-8 | |
| NP00748 | LINSLLGIPKVMTDA |
15 | Penaeus monodon | Arthropod PDH | Pigment-dispersing hormone | 21459120#Chansela P, Goto-Inoue N, Zaima N, Sroyraya M, Sobhon P, Setou M#Visualization of neuropeptides in paraffin-embedded tissue sections of the central nervous system in the decapod crustacean, Penaeus monodon, by imaging mass spectrometry#Peptides 2012 Mar;34(1):10-8 | |
| NP00749 | LLGIPKVMNDA |
11 | Penaeus monodon | Arthropod PDH | Pigment-dispersing hormone | 21459120#Chansela P, Goto-Inoue N, Zaima N, Sroyraya M, Sobhon P, Setou M#Visualization of neuropeptides in paraffin-embedded tissue sections of the central nervous system in the decapod crustacean, Penaeus monodon, by imaging mass spectrometry#Peptides 2012 Mar;34(1):10-8 | |
| NP00750 | NSELINSLLGIP |
12 | Penaeus monodon | Arthropod PDH | Pigment-dispersing hormone | 21459120#Chansela P, Goto-Inoue N, Zaima N, Sroyraya M, Sobhon P, Setou M#Visualization of neuropeptides in paraffin-embedded tissue sections of the central nervous system in the decapod crustacean, Penaeus monodon, by imaging mass spectrometry#Peptides 2012 Mar;34(1):10-8 | |
| NP00751 | NSELINSLLGIPK |
13 | Penaeus monodon | Arthropod PDH | Pigment-dispersing hormone | 21459120#Chansela P, Goto-Inoue N, Zaima N, Sroyraya M, Sobhon P, Setou M#Visualization of neuropeptides in paraffin-embedded tissue sections of the central nervous system in the decapod crustacean, Penaeus monodon, by imaging mass spectrometry#Peptides 2012 Mar;34(1):10-8 | |
| NP00752 | NSELINSLLGIPKVM |
15 | Penaeus monodon | Arthropod PDH | Pigment-dispersing hormone | 21459120#Chansela P, Goto-Inoue N, Zaima N, Sroyraya M, Sobhon P, Setou M#Visualization of neuropeptides in paraffin-embedded tissue sections of the central nervous system in the decapod crustacean, Penaeus monodon, by imaging mass spectrometry#Peptides 2012 Mar;34(1):10-8 | |
| NP00753 | NSELINSLLGIPKVMNDA |
18 | Penaeus monodon | Arthropod PDH | Pigment-dispersing hormone | 21459120#Chansela P, Goto-Inoue N, Zaima N, Sroyraya M, Sobhon P, Setou M#Visualization of neuropeptides in paraffin-embedded tissue sections of the central nervous system in the decapod crustacean, Penaeus monodon, by imaging mass spectrometry#Peptides 2012 Mar;34(1):10-8 | |
| NP00754 | NSELINSLLGIPKVMTDA |
18 | Penaeus monodon | Arthropod PDH | Pigment-dispersing hormone | 21459120#Chansela P, Goto-Inoue N, Zaima N, Sroyraya M, Sobhon P, Setou M#Visualization of neuropeptides in paraffin-embedded tissue sections of the central nervous system in the decapod crustacean, Penaeus monodon, by imaging mass spectrometry#Peptides 2012 Mar;34(1):10-8 | |
| NP00755 | RSIAVVVL |
8 | Penaeus monodon | Arthropod PDH | Pigment-dispersing hormone | 21459120#Chansela P, Goto-Inoue N, Zaima N, Sroyraya M, Sobhon P, Setou M#Visualization of neuropeptides in paraffin-embedded tissue sections of the central nervous system in the decapod crustacean, Penaeus monodon, by imaging mass spectrometry#Peptides 2012 Mar;34(1):10-8 | |
| NP00756 | RVAQGPSAFVAGPH |
14 | Penaeus monodon | Arthropod PDH | Pigment-dispersing hormone | 21459120#Chansela P, Goto-Inoue N, Zaima N, Sroyraya M, Sobhon P, Setou M#Visualization of neuropeptides in paraffin-embedded tissue sections of the central nervous system in the decapod crustacean, Penaeus monodon, by imaging mass spectrometry#Peptides 2012 Mar;34(1):10-8 | |
| NP00757 | VAQGPSAFVAG |
11 | Penaeus monodon | Arthropod PDH | Pigment-dispersing hormone | 21459120#Chansela P, Goto-Inoue N, Zaima N, Sroyraya M, Sobhon P, Setou M#Visualization of neuropeptides in paraffin-embedded tissue sections of the central nervous system in the decapod crustacean, Penaeus monodon, by imaging mass spectrometry#Peptides 2012 Mar;34(1):10-8 | |
| NP00758 | QSRDFSISEREIVASLAKQLLRVARMGYVPEGDLPR |
36 | Eurydice pulchra | Arthropod PDH | PDH precursor-related peptide(Potential) | ||
| NP00759 | NAELINSLLGVPRVMSDA |
18 | Eurydice pulchra | Arthropod PDH | Pigment-dispersing hormone | 21192084#Wilcockson D.C., Zhang L., Hastings M.H., Kyriacou C.P., Webster S.G.; #A novel form of pigment-dispersing hormone in the central nervous system of the intertidal marine isopod, Eurydice pulchra (leach).; #J. Comp. Neurol. 519:562-575(2011). | |
| NP00760 | NSELINAILGSPTLFGEV |
18 | Orconectes limosus | Arthropod PDH | Pigment-dispersing hormone B | 14981133#Bulau P., Meisen I., Schmitz T., Keller R., Peter-Katalinic J.; #Identification of neuropeptides from the sinus gland of the crayfish Orconectes limosus using nanoscale on-line liquid chromatography tandem mass spectrometry.; #Mol. Cell. Proteomics 3:558-564(2004). | |
| NP00761 | NSELINAILGSPTLMGEV |
18 | Orconectes limosus | Arthropod PDH | Pigment-dispersing hormone C | 14981133#Bulau P., Meisen I., Schmitz T., Keller R., Peter-Katalinic J.; #Identification of neuropeptides from the sinus gland of the crayfish Orconectes limosus using nanoscale on-line liquid chromatography tandem mass spectrometry.; #Mol. Cell. Proteomics 3:558-564(2004). | |
| NP00762 | NSELINSILGLPKVMNDA |
18 | Cancer productus | Arthropod PDH | Canpr-beta-PDH I | 18311785#Hsu YW, Stemmler EA, Messinger DI, Dickinson PS, Christie AE, de la Iglesia HO#Cloning and differential expression of two beta-pigment-dispersing hormone (beta-PDH) isoforms in the crab Cancer productus: evidence for authentic beta-PDH as a local neurotransmitter and beta-PDH II as a humoral factor#J Comp Neurol 2008 May 10;508(2):197-211 | |
| NP00763 | NSELINSLLGLSRLMNEA |
18 | Cancer productus | Arthropod PDH | Canpr-beta-PDH II | 18311785#Hsu YW, Stemmler EA, Messinger DI, Dickinson PS, Christie AE, de la Iglesia HO#Cloning and differential expression of two beta-pigment-dispersing hormone (beta-PDH) isoforms in the crab Cancer productus: evidence for authentic beta-PDH as a local neurotransmitter and beta-PDH II as a humoral factor#J Comp Neurol 2008 May 10;508(2):197-211 | |
| NP00764 | NSELINSLLGIPKVMTDA |
18 | Penaeus japonicus | Arthropod PDH | Pej-PDH-I | 10336829#Yang WJ, Aida K, Nagasawa H#Characterization of chromatophorotropic neuropeptides from the kuruma prawn Penaeus japonicus#Gen Comp Endocrinol 1999 Jun;114(3):415-24 | |
| NP00765 | NSELINSILGLPKVMNDA |
18 | Callinectes sapidus | Arthropod PDH | Pigment-dispersing hormone | 21740068#Hui L, Cunningham R, Zhang Z, Cao W, Jia C, Li L#Discovery and characterization of the Crustacean hyperglycemic hormone precursor related peptides (CPRP) and orcokinin neuropeptides in the sinus glands of the blue crab Callinectes sapidus using multiple tandem mass spectrometry techniques#J Proteome Res 2011 Sep 2;10(9):4219-29 | |
| NP00766 | NSELINSILGLPKVMNDA |
18 | Carcinus maenas | Arthropod PDH | Pigment-dispersing hormone | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 |