Total number of results for Carcinus maenas are 120
Download
as Fasta All
| NPID | Sequence | Length | Organism | Family | Name | PMID | Peptide_REF |
|---|---|---|---|---|---|---|---|
| NP00233 | QLNFSPGW |
8 | Carcinus maenas | AKH/HRTH/RPCH | Red pigment-concentrating hormone | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP00356 | AAPYAFGL |
8 | Carcinus maenas | Allatostatin | Allatostatin A | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP00357 | AASPYSFGL |
9 | Carcinus maenas | Allatostatin | Allatostatin A | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP00358 | APGPYAFGL |
9 | Carcinus maenas | Allatostatin | Allatostatin A | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP00359 | ARPYAFGL |
8 | Carcinus maenas | Allatostatin | Allatostatin A | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP00360 | ARPYSFGL |
8 | Carcinus maenas | Allatostatin | Allatostatin A | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP00361 | EPYEFGL |
7 | Carcinus maenas | Allatostatin | Allatostatin A | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP00362 | FSGASPYGL |
9 | Carcinus maenas | Allatostatin | Allatostatin A | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP00363 | GKPYAFGL |
8 | Carcinus maenas | Allatostatin | Allatostatin A | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP00364 | KLPYSFGL |
8 | Carcinus maenas | Allatostatin | Allatostatin A | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP00365 | LKAYDFGL |
8 | Carcinus maenas | Allatostatin | Allatostatin A | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP00366 | PADLYEFGL |
9 | Carcinus maenas | Allatostatin | Allatostatin A | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP00367 | RGPYAFGL |
8 | Carcinus maenas | Allatostatin | Allatostatin A | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP00368 | TRPYSFGL |
8 | Carcinus maenas | Allatostatin | Allatostatin A | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP00369 | AGWNKFQGSW |
10 | Carcinus maenas | Allatostatin | Allatostatin B | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP00370 | AWSNLGQAW |
9 | Carcinus maenas | Allatostatin | Allatostatin B | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP00371 | GSNWSNLRGAW |
11 | Carcinus maenas | Allatostatin | Allatostatin B | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP00372 | GVNWSNLRGAW |
11 | Carcinus maenas | Allatostatin | Allatostatin B | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP00373 | NNNWSKFQGSW |
11 | Carcinus maenas | Allatostatin | Allatostatin B | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP00374 | NNWSKFQGSW |
10 | Carcinus maenas | Allatostatin | Allatostatin B | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP00375 | QWSSMRGAW |
9 | Carcinus maenas | Allatostatin | Allatostatin B | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP00376 | SGKWSNLRGAW |
11 | Carcinus maenas | Allatostatin | Allatostatin B | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP00377 | STNWSSLRSAW |
11 | Carcinus maenas | Allatostatin | Allatostatin B | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP00378 | TSWGKFQGSW |
10 | Carcinus maenas | Allatostatin | Allatostatin B | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP00379 | VPNDWAHFRGSW |
12 | Carcinus maenas | Allatostatin | Allatostatin B | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP00380 | VTWGKFQGSW |
10 | Carcinus maenas | Allatostatin | Allatostatin B | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP00381 | GGPYSXGL |
8 | Carcinus maenas | Allatostatin | Carcinustatin-16 | 9461295#Duve H, Johnsen AH, Maestro JL, Scott AG, Jaros PP, Thorpe A#Isolation and identification of multiple neuropeptides of the allatostatin superfamily in the shore crab Carcinus maenas#Eur J Biochem 1997 Dec 15;250(3):727-34 | |
| NP00519 | APQPYAFGL |
9 | Carcinus maenas | Allatostatin | Carcinustatin-10 | 9461295#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Jaros P.P., Thorpe A.; #Isolation and identification of multiple neuropeptides of the allatostatin superfamily in the shore crab Carcinus maenas.; #Eur. J. Biochem. 250:727-734(1997). | |
| NP00520 | ATGQYAFGL |
9 | Carcinus maenas | Allatostatin | Carcinustatin-11 | 9461295#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Jaros P.P., Thorpe A.; #Isolation and identification of multiple neuropeptides of the allatostatin superfamily in the shore crab Carcinus maenas.; #Eur. J. Biochem. 250:727-734(1997). | |
| NP00521 | PDMYAFGL |
8 | Carcinus maenas | Allatostatin | Carcinustatin-12 | 9461295#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Jaros P.P., Thorpe A.; #Isolation and identification of multiple neuropeptides of the allatostatin superfamily in the shore crab Carcinus maenas.; #Eur. J. Biochem. 250:727-734(1997). | |
| NP00522 | EYDDMYTEKRPKVYAFGL |
18 | Carcinus maenas | Allatostatin | Carcinustatin-13 | 9461295#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Jaros P.P., Thorpe A.; #Isolation and identification of multiple neuropeptides of the allatostatin superfamily in the shore crab Carcinus maenas.; #Eur. J. Biochem. 250:727-734(1997). | |
| NP00523 | YSFGL |
5 | Carcinus maenas | Allatostatin | Carcinustatin-14 | 9461295#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Jaros P.P., Thorpe A.; #Isolation and identification of multiple neuropeptides of the allatostatin superfamily in the shore crab Carcinus maenas.; #Eur. J. Biochem. 250:727-734(1997). | |
| NP00524 | AGPYSFGL |
8 | Carcinus maenas | Allatostatin | Carcinustatin-15 | 9461295#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Jaros P.P., Thorpe A.; #Isolation and identification of multiple neuropeptides of the allatostatin superfamily in the shore crab Carcinus maenas.; #Eur. J. Biochem. 250:727-734(1997). | |
| NP00525 | GGPYSYGL |
8 | Carcinus maenas | Allatostatin | Carcinustatin-16 | 9461295#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Jaros P.P., Thorpe A.; #Isolation and identification of multiple neuropeptides of the allatostatin superfamily in the shore crab Carcinus maenas.; #Eur. J. Biochem. 250:727-734(1997). | |
| NP00526 | SGQYSFGL |
8 | Carcinus maenas | Allatostatin | Carcinustatin-17 | 9461295#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Jaros P.P., Thorpe A.; #Isolation and identification of multiple neuropeptides of the allatostatin superfamily in the shore crab Carcinus maenas.; #Eur. J. Biochem. 250:727-734(1997). | |
| NP00527 | SDMYSFGL |
8 | Carcinus maenas | Allatostatin | Carcinustatin-18 | 9461295#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Jaros P.P., Thorpe A.; #Isolation and identification of multiple neuropeptides of the allatostatin superfamily in the shore crab Carcinus maenas.; #Eur. J. Biochem. 250:727-734(1997). | |
| NP00528 | APTDMYSFGL |
10 | Carcinus maenas | Allatostatin | Carcinustatin-19 | 9461295#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Jaros P.P., Thorpe A.; #Isolation and identification of multiple neuropeptides of the allatostatin superfamily in the shore crab Carcinus maenas.; #Eur. J. Biochem. 250:727-734(1997). | |
| NP00529 | EAYAFGL |
7 | Carcinus maenas | Allatostatin | Carcinustatin-2 | 9461295#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Jaros P.P., Thorpe A.; #Isolation and identification of multiple neuropeptides of the allatostatin superfamily in the shore crab Carcinus maenas.; #Eur. J. Biochem. 250:727-734(1997). | |
| NP00530 | GYEDEDEDRPFYALGLGKRPRTYSFGL |
27 | Carcinus maenas | Allatostatin | Carcinustatin-20 | 9461295#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Jaros P.P., Thorpe A.; #Isolation and identification of multiple neuropeptides of the allatostatin superfamily in the shore crab Carcinus maenas.; #Eur. J. Biochem. 250:727-734(1997). | |
| NP00531 | EPYAFGL |
7 | Carcinus maenas | Allatostatin | Carcinustatin-3 | 9461295#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Jaros P.P., Thorpe A.; #Isolation and identification of multiple neuropeptides of the allatostatin superfamily in the shore crab Carcinus maenas.; #Eur. J. Biochem. 250:727-734(1997). | |
| NP00532 | DPYAFGL |
7 | Carcinus maenas | Allatostatin | Carcinustatin-4 | 9461295#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Jaros P.P., Thorpe A.; #Isolation and identification of multiple neuropeptides of the allatostatin superfamily in the shore crab Carcinus maenas.; #Eur. J. Biochem. 250:727-734(1997). | |
| NP00533 | NPYAFGL |
7 | Carcinus maenas | Allatostatin | Carcinustatin-5 | 9461295#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Jaros P.P., Thorpe A.; #Isolation and identification of multiple neuropeptides of the allatostatin superfamily in the shore crab Carcinus maenas.; #Eur. J. Biochem. 250:727-734(1997). | |
| NP00534 | YAFGL |
5 | Carcinus maenas | Allatostatin | Carcinustatin-1 | 9461295#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Jaros P.P., Thorpe A.; #Isolation and identification of multiple neuropeptides of the allatostatin superfamily in the shore crab Carcinus maenas.; #Eur. J. Biochem. 250:727-734(1997). | |
| NP00535 | SPYAFGL |
7 | Carcinus maenas | Allatostatin | Carcinustatin-6 | 9461295#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Jaros P.P., Thorpe A.; #Isolation and identification of multiple neuropeptides of the allatostatin superfamily in the shore crab Carcinus maenas.; #Eur. J. Biochem. 250:727-734(1997). | |
| NP00536 | ASPYAFGL |
8 | Carcinus maenas | Allatostatin | Carcinustatin-7 | 9461295#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Jaros P.P., Thorpe A.; #Isolation and identification of multiple neuropeptides of the allatostatin superfamily in the shore crab Carcinus maenas.; #Eur. J. Biochem. 250:727-734(1997). | |
| NP00537 | AGPYAFGL |
8 | Carcinus maenas | Allatostatin | Carcinustatin-8 | 9461295#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Jaros P.P., Thorpe A.; #Isolation and identification of multiple neuropeptides of the allatostatin superfamily in the shore crab Carcinus maenas.; #Eur. J. Biochem. 250:727-734(1997). | |
| NP00538 | GGPYAFGL |
8 | Carcinus maenas | Allatostatin | Carcinustatin-9 | 9461295#Duve H., Johnsen A.H., Maestro J.-L., Scott A.G., Jaros P.P., Thorpe A.; #Isolation and identification of multiple neuropeptides of the allatostatin superfamily in the shore crab Carcinus maenas.; #Eur. J. Biochem. 250:727-734(1997). | |
| NP00644 | PSAALAVEHGTTHPLE |
16 | Carcinus maenas | Arthropod CHH/MIH/GIH/VIH hormone | CHH precursor-related peptide | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP00645 | RSTPGYGRMDRIL |
13 | Carcinus maenas | Arthropod CHH/MIH/GIH/VIH hormone | CHH precursor-related peptide | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP00646 | RSTPGYGRMDRILAA |
15 | Carcinus maenas | Arthropod CHH/MIH/GIH/VIH hormone | CHH precursor-related peptide | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP00647 | RSTPGYGRMDRILAALKTSPMEPSAALAVEHGTTHPLE |
38 | Carcinus maenas | Arthropod CHH/MIH/GIH/VIH hormone | CHH precursor-related peptide | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP00648 | RSTQGYGRMDPIL |
13 | Carcinus maenas | Arthropod CHH/MIH/GIH/VIH hormone | CHH precursor-related peptide | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP00649 | RSTQGYGRMDRILAA |
15 | Carcinus maenas | Arthropod CHH/MIH/GIH/VIH hormone | CHH precursor-related peptide | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP00650 | RSTQGYGRMDRILAALKTSPMEPSAALAVEHGTTHPLE |
38 | Carcinus maenas | Arthropod CHH/MIH/GIH/VIH hormone | CHH precursor-related peptide | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP00651 | SPMEPSAALAVEHGTTHPLE |
20 | Carcinus maenas | Arthropod CHH/MIH/GIH/VIH hormone | CHH precursor-related peptide | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP00652 | TSPMEPSAALAVEHGTTHPLE |
21 | Carcinus maenas | Arthropod CHH/MIH/GIH/VIH hormone | CHH precursor-related peptide | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP00684 | RSTQGYGRMDRILAALKTSPMEPSAALAVENGTTHPLE |
38 | Carcinus maenas | Arthropod CHH/MIH/GIH/VIH hormone | CHH precursor-related peptide | 1788131#Tensen C.P., Verhoeven A.H.M., Gaus G., Janssen K.P.C., Keller R., van Herp F.; #Isolation and amino acid sequence of crustacean hyperglycemic hormone precursor-related peptides.; #Peptides 12:673-681(1991). | |
| NP00685 | QIYDTSCKGVYDRALFNDLEHVCDDCYNLYRTSYVASACRSNCYSNLVFRQCMDDLLMMDEFDQYARKVQMV |
72 | Carcinus maenas | Arthropod CHH/MIH/GIH/VIH hormone | Crustacean hyperglycemic hormone | 2792364# Kegel G., Reichwein B., Weese S., Gaus G., Peter-Katalinic J., Keller R.; #Amino acid sequence of the crustacean hyperglycemic hormone (CHH) from the shore crab, Carcinus maenas.; # FEBS Lett. 255:10-14(1989).$8841399#Chung J.S., Webster S.G.; #Does the N-terminal pyroglutamate residue have any physiological significance for crab hyperglycemic neuropeptides?; #Eur. J. Biochem. 240:358-364(1996). | |
| NP00686 | RVINDECPNLIGNRDLYKKVEWICEDCSNIFRKTGMASLCRRNCFFNEDFVWCVHATERSEELRDLEEWVGILGAGRD |
78 | Carcinus maenas | Arthropod CHH/MIH/GIH/VIH hormone | Molt-inhibiting hormone | 1679945#Webster S.G.; #Amino acid sequence of putative moult-inhibiting hormone from the crab Carcinus maenas.; #Proc. R. Soc. B 244:247-252(1991). | |
| NP00766 | NSELINSILGLPKVMNDA |
18 | Carcinus maenas | Arthropod PDH | Pigment-dispersing hormone | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP00893 | PFCNAFTGC |
9 | Carcinus maenas | CCAP | Cardioactive peptide | 16593803#Stangier J., Hilbich C., Beyreuther K., Keller R.; #Unusual cardioactive peptide (CCAP) from pericardial organs of the shore crab Carcinus maenas.; #Proc. Natl. Acad. Sci. U.S.A. 84:575-579(1987). | |
| NP01028 | QTFQYSRGWTN |
11 | Carcinus maenas | Corazonin | Corazonin | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP01445 | APQGNFLRF |
9 | Carcinus maenas | FMRFamide related peptide | FMRFamide-like peptide | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP01446 | APQRNFLRF |
9 | Carcinus maenas | FMRFamide related peptide | FMRFamide-like peptide | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP01447 | DARTPALRLRF |
11 | Carcinus maenas | FMRFamide related peptide | FMRFamide-like peptide | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP01448 | DGNRNFLRF |
9 | Carcinus maenas | FMRFamide related peptide | FMRFamide-like peptide | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP01449 | DRNFLRF |
7 | Carcinus maenas | FMRFamide related peptide | FMRFamide-like peptide | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP01450 | EMPSLRLRF |
9 | Carcinus maenas | FMRFamide related peptide | FMRFamide-like peptide | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP01451 | GAHKNYLRF |
9 | Carcinus maenas | FMRFamide related peptide | FMRFamide-like peptide | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP01452 | GLSRNYLRF |
9 | Carcinus maenas | FMRFamide related peptide | FMRFamide-like peptide | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP01453 | NRNFLRF |
7 | Carcinus maenas | FMRFamide related peptide | FMRFamide-like peptide | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP01454 | NRSFLRF |
7 | Carcinus maenas | FMRFamide related peptide | FMRFamide-like peptide | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP01455 | QGNFLRF |
7 | Carcinus maenas | FMRFamide related peptide | FMRFamide-like peptide | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP01456 | RNFLRF |
6 | Carcinus maenas | FMRFamide related peptide | FMRFamide-like peptide | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP01457 | SENRNFLRF |
9 | Carcinus maenas | FMRFamide related peptide | FMRFamide-like peptide | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP01458 | SMPSLRLRF |
9 | Carcinus maenas | FMRFamide related peptide | FMRFamide-like peptide | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP01459 | SRNYLRF |
7 | Carcinus maenas | FMRFamide related peptide | FMRFamide-like peptide | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP01460 | YGNRSFLRF |
9 | Carcinus maenas | FMRFamide related peptide | FMRFamide-like peptide | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP01461 | GYRKPPFNGSIF |
12 | Carcinus maenas | FMRFamide related peptide | SIFamide | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP01462 | RKPPFNGSIF |
10 | Carcinus maenas | FMRFamide related peptide | SIFamide | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP01463 | VYRKPPFNGSIF |
12 | Carcinus maenas | FMRFamide related peptide | SIFamide | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP03061 | QDLDHVFLRF |
10 | Carcinus maenas | Myosuppressin | Myosuppressin | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP03343 | KIFEPLR |
7 | Carcinus maenas | NA | NA | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP03344 | KIFEPLRDKN |
10 | Carcinus maenas | NA | NA | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP03345 | KIFEPLRDKNL |
11 | Carcinus maenas | NA | NA | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP03346 | KIFEPLVA |
8 | Carcinus maenas | NA | NA | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP03347 | HIGSLYR |
7 | Carcinus maenas | NA | YRamide | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP03522 | RYLPT |
5 | Carcinus maenas | NA | Proctolin | 2872661#Stangier J., Dircksen H., Keller R.; #Identification and immunocytochemical localization of proctolin in pericardial organs of the shore crab, Carcinus maenas.; #Peptides 7:67-72(1986). | |
| NP03808 | PSLRLRF |
7 | Carcinus maenas | NPY | Short neuropeptide F | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP03809 | PSMRLRF |
7 | Carcinus maenas | NPY | Short neuropeptide F | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP03989 | EGFYSQRY |
8 | Carcinus maenas | NPY | RYamide | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP03990 | FVGGSRY |
7 | Carcinus maenas | NPY | RYamide | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP03991 | FYANRY |
6 | Carcinus maenas | NPY | RYamide | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP03992 | FYSQRY |
6 | Carcinus maenas | NPY | RYamide | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP03993 | SGFYADRY |
8 | Carcinus maenas | NPY | RYamide | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP03994 | SGFYAPRY |
8 | Carcinus maenas | NPY | RYamide | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP03995 | SSRFVGGSRY |
10 | Carcinus maenas | NPY | RYamide | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP04260 | EIDRSGFGFA |
10 | Carcinus maenas | Orcokinin | Orcokinin | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP04261 | FDEIDRSGFGFA |
12 | Carcinus maenas | Orcokinin | Orcokinin | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP04262 | NFDEIDRSGF |
10 | Carcinus maenas | Orcokinin | Orcokinin | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP04263 | NFDEIDRSGFA |
11 | Carcinus maenas | Orcokinin | Orcokinin | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP04264 | NFDEIDRSGFG |
11 | Carcinus maenas | Orcokinin | Orcokinin | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP04265 | NFDEIDRSGFGF |
12 | Carcinus maenas | Orcokinin | Orcokinin | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP04266 | NFDEIDRSGFGFA |
13 | Carcinus maenas | Orcokinin | Orcokinin | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP04267 | NFDEIDRSGFGFN |
13 | Carcinus maenas | Orcokinin | Orcokinin | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP04268 | NFDEIDRSGFGFV |
13 | Carcinus maenas | Orcokinin | Orcokinin | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP04269 | NFDEIDRSSF |
10 | Carcinus maenas | Orcokinin | Orcokinin | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP04270 | NFDEIDRSSFA |
11 | Carcinus maenas | Orcokinin | Orcokinin | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP04271 | NFDEIDRSSFG |
11 | Carcinus maenas | Orcokinin | Orcokinin | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP04272 | NFDEIDRSSFGFN |
13 | Carcinus maenas | Orcokinin | Orcokinin | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP04273 | NFDEIDRSSFGFV |
13 | Carcinus maenas | Orcokinin | Orcokinin | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP04274 | FDAFTTGFGHS |
11 | Carcinus maenas | Orcokinin | Orcomyotropin | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP04962 | DTGFAFSPRL |
10 | Carcinus maenas | Pyrokinin | Pyrokinin | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP04963 | LYFAPRL |
7 | Carcinus maenas | Pyrokinin | Pyrokinin | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP04964 | TSFAFSPRL |
9 | Carcinus maenas | Pyrokinin | Pyrokinin | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP05556 | APSGFLGMR |
9 | Carcinus maenas | Tachykinin | Tachykinin | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP05557 | APSGFLGMRG |
10 | Carcinus maenas | Tachykinin | Tachykinin | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP05558 | TPSGFLGMR |
9 | Carcinus maenas | Tachykinin | Tachykinin | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP05559 | PSGFLGMR |
8 | Carcinus maenas | Tachykinin | Tachykinin-related peptide | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 | |
| NP05560 | SGFLGMR |
7 | Carcinus maenas | Tachykinin | Tachykinin-related peptide | 19523386#Ma M, Bors EK, Dickinson ES, Kwiatkowski MA, Sousa GL, Henry RP, Smith CM, Towle DW, Christie AE, Li L#Characterization of the Carcinus maenas neuropeptidome by mass spectrometry and functional genomics#Gen Comp Endocrinol 2009 May;161(3):320-34 |