Total number of results for Galanin are 30
Download
as Fasta All
NPID | Sequence | Length | Organism | Family | Name | PMID | Peptide_REF |
---|---|---|---|---|---|---|---|
NP02011 |
GWTNLSAGYLLGPHAVDNHRSLNDKHGLA
|
29 | Amia calva | Galanin | Galanin | 7527531#Wang Y, Conlon JM#Purification and characterization of galanin from the phylogenetically ancient fish, the bowfin (Amia calva) and dogfish (Scyliorhinus canicula)#Peptides 1994;15(6):981-6 | |
NP02012 |
GWTNLSAGYLLGPHAVDNHRSLNDKHGLA
|
29 | Scyliorhinus canicula | Galanin | Galanin | 7527531#Wang Y, Conlon JM#Purification and characterization of galanin from the phylogenetically ancient fish, the bowfin (Amia calva) and dogfish (Scyliorhinus canicula)#Peptides 1994;15(6):981-6 | |
NP02013 |
PAHRGRGGWTLNSAGYLLGPVLHLPQMGDQDGKRETALEILDLWKAIDGLPYSHPPQPS
|
59 | Ciona intestinalis | Galanin | Ci-GALP | 21467196#Kawada T, Ogasawara M, Sekiguchi T, Aoyama M, Hotta K, Oka K, Satake H#Peptidomic analysis of the central nervous system of the protochordate, Ciona intestinalis: homologs and prototypes of vertebrate peptides and novel peptides#Endocrinology 2011 Jun;152(6):2416-27 | |
NP02014 |
PFRGQGGWTLNSVGYNAGLGALRKLFE
|
27 | Ciona intestinalis | Galanin | Ci-GALP | 21467196#Kawada T, Ogasawara M, Sekiguchi T, Aoyama M, Hotta K, Oka K, Satake H#Peptidomic analysis of the central nervous system of the protochordate, Ciona intestinalis: homologs and prototypes of vertebrate peptides and novel peptides#Endocrinology 2011 Jun;152(6):2416-27 | |
NP02015 |
GWTLNSAGYLLGPHAIDSHRSLGDKRGVA
|
29 | Ciona intestinalis | Galanin | Galanin | 21467196#Kawada T, Ogasawara M, Sekiguchi T, Aoyama M, Hotta K, Oka K, Satake H#Peptidomic analysis of the central nervous system of the protochordate, Ciona intestinalis: homologs and prototypes of vertebrate peptides and novel peptides#Endocrinology 2011 Jun;152(6):2416-27 | |
NP02016 |
GWTLNSAGYLLGPHAVDNHRSFNDKHGFT
|
29 | Ciona intestinalis | Galanin | Galanin | 21467196#Kawada T, Ogasawara M, Sekiguchi T, Aoyama M, Hotta K, Oka K, Satake H#Peptidomic analysis of the central nervous system of the protochordate, Ciona intestinalis: homologs and prototypes of vertebrate peptides and novel peptides#Endocrinology 2011 Jun;152(6):2416-27 | |
NP02017 |
GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS
|
30 | Ciona intestinalis | Galanin | Galanin | 21467196#Kawada T, Ogasawara M, Sekiguchi T, Aoyama M, Hotta K, Oka K, Satake H#Peptidomic analysis of the central nervous system of the protochordate, Ciona intestinalis: homologs and prototypes of vertebrate peptides and novel peptides#Endocrinology 2011 Jun;152(6):2416-27 | |
NP02018 |
GWTLNSAGYLLGPHAIDNHRSFNEKHGIA
|
29 | Alligator mississippiensis | Galanin | Galanin | 7524049#Wang Y., Conlon J.M.; #Purification and primary structure of galanin from the alligator stomach.; #Peptides 15:603-606(1994). | |
NP02019 |
GWTLNSAGYLLGPHAVDNHRSLNDKHGLA
|
29 | Amia calva | Galanin | Galanin | 7527531#Wang Y., Conlon J.M.; #Purification and characterization of galanin from the phylogenetically ancient fish, the bowfin (Amia calva) and dogfish (Scyliorhinus canicula).; #Peptides 15:981-986(1994). | |
NP02020 |
GWTLNSAGYLLGPHALDSHRSFQDKHGLA
|
29 | Bos taurus | Galanin | Galanin | ||
NP02021 |
ELEPEDEARPGSFDRPLAENNVVRTIIEFLTFLHLKDAGALERLPSLPTAESAEDAERS
|
59 | Bos taurus | Galanin | Galanin message-associated peptide | ||
NP02022 |
GWTLNSAGYLLGPHAVDNHRSFNDKHGFT
|
29 | Coturnix coturnix japonica | Galanin | Galanin | ||
NP02023 |
EIQPEEDIKAGNIGRPLADENIVRTVVEFLTYLHLKEAGALDNLPSPEETNES
|
53 | Coturnix coturnix japonica | Galanin | Galanin message-associated peptide | ||
NP02024 |
GWTLNSAGYLLGPHAVDNHRSFNDKHGFT
|
29 | Gallus gallus | Galanin | Galanin | 1715289#Norberg A., Sillard R., Carlquist M., Joernvall H., Mutt V.; #Chemical detection of natural peptides by specific structures. Isolation of chicken galanin by monitoring for its N-terminal dipeptide, and determination of the amino acid sequence.; #FEBS Lett. 288:151-153(1991). | |
NP02025 |
GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS
|
30 | Homo sapiens | Galanin | Galanin | 1710578# Bersani M., Johnsen A.H., Hoejrup P., Dunning B.E., Andreasen J.J., Holst J.J.; #Human galanin: primary structure and identification of two molecular forms.;# FEBS Lett. 283:189-194(1991).$1722333#Schmidt W.E., Kratzin H., Eckart K., Drevs D., Mundkowski G., Clemens A., Katsoulis S., Schaefer H., Gallwitz B., Creutzfeldt W.; #Isolation and primary structure of pituitary human galanin, a 30- residue nonamidated neuropeptide.;#Proc. Natl. Acad. Sci. U.S.A. 88:11435-11439(1991). | |
NP02026 |
ELRPEDDMKPGSFDRSIPENNIMRTIIEFLSFLHLKEAGALDRLLDLPAAASSEDIERS
|
59 | Homo sapiens | Galanin | Galanin message-associated peptide | ||
NP02027 |
GWTLNSAGYLLGPHAIDNHRSFSDKHGLT
|
29 | Mus musculus | Galanin | Galanin (By similarity) | ||
NP02028 |
ELQLEVEERRPGSVDVPLPESNIVRTIMEFLSFLHLKEAGALDSLPGIPLATSSEDLEKS
|
60 | Mus musculus | Galanin | Galanin message-associated peptide (Bysimilarity) | ||
NP02029 |
GWTLNSAGYLLGPHGIDGHRTLSDKHGLA
|
29 | Oncorhynchus mykiss | Galanin | Galanin | 7532194#Anglade I., Wang Y., Jensen J., Tramu G., Kah O., Conlon J.M.;#Characterization of trout galanin and its distribution in trout brain and pituitary.;#J. Comp. Neurol. 350:63-74(1994). | |
NP02030 |
GWTLNSAGYLLGPHAIDNHRSFHDKHGLA
|
29 | Ovis aries | Galanin | Galanin | 1724081#Sillard R., Langel U., Joernvall H.; #Isolation and characterization of galanin from sheep brain.; #Peptides 12:855-859(1991). | |
NP02031 |
GWTLNSAGYLLGPHAIDNHRSFNDKHGLA
|
29 | Pelophylax ridibundus | Galanin | Galanin | 7540547#Chartrel N., Wang Y., Fournier A., Vaudry H., Conlon J.M.;#Frog vasoactive intestinal polypeptide and galanin: primary structures and effects on pituitary adenylate cyclase.;#Endocrinology 136:3079-3086(1995). | |
NP02032 |
GWTLNSAGYLLGPHAIDNHRSFSDKHGLT
|
29 | Rattus norvegicus | Galanin | Galanin | ||
NP02033 |
ELPLEVEEGRLGSVAVPLPESNIVRTIMEFLSFLHLKEAGALDSLPGIPLATSSEDLEQS
|
60 | Rattus norvegicus | Galanin | Galanin message-associated peptide | ||
NP02034 |
GWTLNSAGYLLGPHAIDNHRSFHDKYGLA
|
29 | Sus scrofa | Galanin | Galanin | 6197320#Tatemoto K., Rokaeus A., Joernvall H., McDonald T.J., Mutt V.; #Galanin - a novel biologically active peptide from porcine intestine.; #FEBS Lett. 164:124-128(1983).$1381832#McDonald T.J., Krantis A., Clarke M., Mutt V., Joernvall H.; #Characterization of porcine gastric galanin.; #Peptides 13:589-593(1992). | |
NP02035 |
ELEPEDEARPGGFDRLQSEDKAIRTIMEFLAFLHLKEAGALGRLPGLPSAASSEDAGQS
|
59 | Sus scrofa | Galanin | Galanin message-associated peptide | ||
NP02036 |
APVHRGRGGWTLNSAGYLLGPVLHPPSRAEGGGKGKTALGILDLWKAIDGLPYPQSQLAS
|
60 | Sus scrofa | Galanin | Galanin-like peptide | 10601261#Ohtaki T., Kumano S., Ishibashi Y., Ogi K., Matsui H., Harada M., Kitada C., Kurokawa T., Onda H., Fujino M.; #Isolation and cDNA cloning of a novel galanin-like peptide (GALP) from porcine hypothalamus.; #J. Biol. Chem. 274:37041-37045(1999). | |
NP02037 |
APAHQGRGGWTLNSAGYLLGPVLHLPQMGDQDRKRETALEILDLWKAIDGLPYSHPLQPS
|
60 | Macaca nemestrina | Galanin | Galanin-like peptide | ||
NP02038 |
APAHRGRGGWTLNSAGYLLGPVLPVSSKADQGRKRDSALEILDLWKIIDGLPYSHSPRMT
|
60 | Mus musculus | Galanin | Galanin-like peptide | ||
NP02039 |
APAHRGRGGWTLNSAGYLLGPVLHLSSKANQGRKTDSALEILDLWKAIDGLPYSRSPRMT
|
60 | Rattus norvegicus | Galanin | Galanin-like peptide | ||
NP02040 |
APAHRGRGGWTLNSAGYLLGPVLHLPQMGDQDGKRETALEILDLWKAIDGLPYSHPPQPS
|
60 | Homo sapiens | Galanin | Galanin-like peptide |