| NPID | NP02038 |
| Name | Galanin-like peptide |
| Organism | Mus musculus |
| NCBI Taxa ID | 10090 |
| Tissue Specificity | Isoform 2 is found in brain, thymus and skin. Isoform 2 is found in the skin, in pericytes covering microvascular arterioles and venules on their abluminal surfaces. In larger vessels, isoform 2 is expressed in layers of smooth muscle cells. Isoform 2 is not detected in endothelial cells. |
| Family | Galanin |
| UniProt ID | GALP_MOUSE |
| Length | 60 |
| Modification | |
| Gene Ontology | |
| Sequence | APAHRGRGGWTLNSAGYLLGPVLPVSSKADQGRKRDSALEILDLWKIIDGLPYSHSPRMT |
| Properties | View |
| Structure | |
| Reference |
Neuropeptide