| NPID | NP02040 |
| Name | Galanin-like peptide |
| Organism | Homo sapiens |
| NCBI Taxa ID | 9606 |
| Tissue Specificity | Isoform 2 is found in ganglia of ganglioneuroma and ganglioneuroblastoma, as well as in differentiated tumor cells of neuroblastoma tissues. Not found in undifferentiated neuroblasts. Isoform 2 is found in the skin, in pericytes covering microvascular arterioles and venules on their abluminal surfaces. In larger vessels, isoform 2 is expressed in layers of smooth muscle cells. Isoform 2 is not detected in endothelial cells. |
| Family | Galanin |
| UniProt ID | GALP_HUMAN |
| Length | 60 |
| Modification | |
| Gene Ontology | |
| Sequence | APAHRGRGGWTLNSAGYLLGPVLHLPQMGDQDGKRETALEILDLWKAIDGLPYSHPPQPS |
| Properties | View |
| Structure | NA |
| Reference |
Neuropeptide