Total number of results for Orconectes limosus are 12
Download
as Fasta All
| NPID | Sequence | Length | Organism | Family | Name | PMID | Peptide_REF |
|---|---|---|---|---|---|---|---|
| NP00255 | PRVYGFGL |
8 | Orconectes limosus | Allatostatin | Allatostatin A | 10477125#Dircksen H, Skiebe P, Abel B, Agricola H, Buchner K, Muren JE, Nässel DR#Structure, distribution, and biological activity of novel members of the allatostatin family in the crayfish Orconectes limosus#Peptides 1999;20(6):695-712 | |
| NP00256 | AGPYAFGL |
8 | Orconectes limosus | Allatostatin | Carcinustatin-8 | 10477125#Dircksen H, Skiebe P, Abel B, Agricola H, Buchner K, Muren JE, Nässel DR#Structure, distribution, and biological activity of novel members of the allatostatin family in the crayfish Orconectes limosus#Peptides 1999;20(6):695-712 | |
| NP00257 | SAGPYAFGL |
9 | Orconectes limosus | Allatostatin | orcostatin I | 10477125#Dircksen H, Skiebe P, Abel B, Agricola H, Buchner K, Muren JE, Nässel DR#Structure, distribution, and biological activity of novel members of the allatostatin family in the crayfish Orconectes limosus#Peptides 1999;20(6):695-712 | |
| NP00677 | RSVESSGSSSSEPLSFLSQDQSVN |
24 | Orconectes limosus | Arthropod CHH/MIH/GIH/VIH hormone | CPRPv1 | 14981133#Bulau P, Meisen I, Schmitz T, Keller R, Peter-Katalinić J#Identification of neuropeptides from the sinus gland of the crayfish Orconectes limosus using nanoscale on-line liquid chromatography tandem mass spectrometry#Mol Cell Proteomics 2004 Jun;3(6):558-64 | |
| NP00678 | RSVESSGSSSSEPLSFLSQDQSVS |
24 | Orconectes limosus | Arthropod CHH/MIH/GIH/VIH hormone | CPRPv2 | 14981133#Bulau P, Meisen I, Schmitz T, Keller R, Peter-Katalinić J#Identification of neuropeptides from the sinus gland of the crayfish Orconectes limosus using nanoscale on-line liquid chromatography tandem mass spectrometry#Mol Cell Proteomics 2004 Jun;3(6):558-64 | |
| NP00703 | RSVEGSSRMERLLSSGSSSSEPLSFLSQDQSVS |
33 | Orconectes limosus | Arthropod CHH/MIH/GIH/VIH hormone | CHH precursor-related peptide A | 1788131#Tensen C.P., Verhoeven A.H.M., Gaus G., Janssen K.P.C., Keller R., van Herp F.; #Isolation and amino acid sequence of crustacean hyperglycemic hormone precursor-related peptides.; #Peptides 12:673-681(1991). | |
| NP00704 | QVFDQACKGIYDRAIFKKLDRVCEDCYNLYRKPYVATTCRQNCYANSVFRQCLDDLLLIDVLDEYISGVQTV |
72 | Orconectes limosus | Arthropod CHH/MIH/GIH/VIH hormone | Crustacean hyperglycemic hormone | 1800954#Kegel G., Reichwein B., Tensen C.P., Keller R.; #Amino acid sequence of crustacean hyperglycemic hormone (CHH) from the crayfish, Orconectes limosus: emergence of a novel neuropeptide family.; #Peptides 12:909-913(1991). | |
| NP00705 | RSVEGSSRMERLLSSGSSSSEPLSFLSQDQSVN |
33 | Orconectes limosus | Arthropod CHH/MIH/GIH/VIH hormone | CHH precursor-related peptide A | 1788131#Tensen C.P., Verhoeven A.H.M., Gaus G., Janssen K.P.C., Keller R., van Herp F.; #Isolation and amino acid sequence of crustacean hyperglycemic hormone precursor-related peptides.; #Peptides 12:673-681(1991). | |
| NP00760 | NSELINAILGSPTLFGEV |
18 | Orconectes limosus | Arthropod PDH | Pigment-dispersing hormone B | 14981133#Bulau P., Meisen I., Schmitz T., Keller R., Peter-Katalinic J.; #Identification of neuropeptides from the sinus gland of the crayfish Orconectes limosus using nanoscale on-line liquid chromatography tandem mass spectrometry.; #Mol. Cell. Proteomics 3:558-564(2004). | |
| NP00761 | NSELINAILGSPTLMGEV |
18 | Orconectes limosus | Arthropod PDH | Pigment-dispersing hormone C | 14981133#Bulau P., Meisen I., Schmitz T., Keller R., Peter-Katalinic J.; #Identification of neuropeptides from the sinus gland of the crayfish Orconectes limosus using nanoscale on-line liquid chromatography tandem mass spectrometry.; #Mol. Cell. Proteomics 3:558-564(2004). | |
| NP04383 | NFDEIDRSGFGFN |
13 | Orconectes limosus | Orcokinin | Orcokinin | 1480511#Stangier J., Hilbich C., Burdzik S., Keller R.; #Orcokinin: a novel myotropic peptide from the nervous system of the crayfish, Orconectes limosus.; #Peptides 13:859-864(1992). | |
| NP04384 | FDAFTTGF |
8 | Orconectes limosus | Orcokinin | Orcomyotropin | 10952880#Dircksen H., Burdzik S., Sauter A., Keller R.; #Two orcokinins and the novel octapeptide orcomyotropin in the hindgut of the crayfish Orconectes limosus: identified myostimulatory neuropeptides originating together in neurones of the terminal abdominal ganglion.; #J. Exp. Biol. 203:2807-2818(2000). |