| NPID | NP00704 |
| Name | Crustacean hyperglycemic hormone |
| Organism | Orconectes limosus |
| NCBI Taxa ID | 28379 |
| Tissue Specificity | Produced by the medulla terminalis X-organ in the eyestalks and transported to the sinus gland where they are stored and released. |
| Family | Arthropod CHH/MIH/GIH/VIH hormone |
| UniProt ID | CHH1_ORCLI |
| Length | 72 |
| Modification | |
| Gene Ontology | |
| Sequence | QVFDQACKGIYDRAIFKKLDRVCEDCYNLYRKPYVATTCRQNCYANSVFRQCLDDLLLIDVLDEYISGVQTV |
| Properties | View |
| Structure | NA |
| Reference |