NPID | NP00703 |
Name | CHH precursor-related peptide A |
Organism | Orconectes limosus |
NCBI Taxa ID | 28379 |
Tissue Specificity | Produced by the medulla terminalis X-organ in the eyestalks and transported to the sinus gland where they are stored and released. |
Family | Arthropod CHH/MIH/GIH/VIH hormone |
UniProt ID | CHH1_ORCLI |
Length | 33 |
Modification | |
Gene Ontology | |
Sequence | RSVEGSSRMERLLSSGSSSSEPLSFLSQDQSVS |
Properties | View |
Structure | NA |
Reference |