Total number of results for NA are 88
Download
as Fasta All
NPID | Sequence | Length | Organism | Family | Name | PMID | Peptide_REF |
---|---|---|---|---|---|---|---|
NP00071 |
ELNFSPNWGN
|
10 | NA | AKH/HRTH/RPCH | Del-CC | 11289079#Nair MM, Jackson GE, Gäde G#Conformational study of insect adipokinetic hormones using NMR constrained molecular dynamics#J Comput Aided Mol Des 2001 Mar;15(3):259-70 | |
NP00072 |
EVNFSPSWGN
|
10 | NA | AKH/HRTH/RPCH | Magicicada species-adipokinetic hormone | 7550248#Raina A, Pannell L, Kochansky J, Jaffe H#Primary structure of a novel neuropeptide isolated from the corpora cardiaca of periodical cicadas having adipokinetic and hypertrehalosemic activities#Insect Biochem Mol Biol 1995 Sep;25(8):929-32 | |
NP00731 |
NSGMINSILGIPRVMTEA
|
18 | NA | Arthropod PDH | pigment-dispersing crustacean neurohormone | 6897116#Riehm JP, Rao KR#Structure-activity relationships of a pigment-dispersing crustacean neurohormone#Peptides 1982 Jul-Aug;3(4):643-7 | |
NP00768 |
EQRLGNQWAVGHLM
|
14 | NA | Bombesin/neuromedin-B/ranatensin | Bombesin | 8496014#Chaturvedi S, Parthasarathy R#Synthesis and immunological properties of bombesin analogs#Int J Pept Protein Res 1993 Apr;41(4):333-7 | |
NP00769 |
APVPGGQGTVLDKMYPRGNHWAVGHLM
|
27 | NA | Bombesin/neuromedin-B/ranatensin | Bombesin-like peptide | 6853532#Reeve JR Jr, Walsh JH, Chew P, Clark B, Hawke D, Shively JE#Amino acid sequences of three bombesin-like peptides from canine intestine extracts#J Biol Chem 1983 May 10;258(9):5582-8 | |
NP00770 |
GGQGTVLDKMYPRGNHWAVGHLM
|
23 | NA | Bombesin/neuromedin-B/ranatensin | Bombesin-like peptide | 6853532#Reeve JR Jr, Walsh JH, Chew P, Clark B, Hawke D, Shively JE#Amino acid sequences of three bombesin-like peptides from canine intestine extracts#J Biol Chem 1983 May 10;258(9):5582-8 | |
NP00771 |
GNHWAVGHLM
|
10 | NA | Bombesin/neuromedin-B/ranatensin | Gastrin-releasing peptide | 22922046#Sioud M, Mobergslien A#Selective killing of cancer cells by peptide-targeted delivery of an anti-microbial peptide#Biochem Pharmacol 2012 Nov 1;84(9):1123-32 | |
NP00804 |
RPPGFSPFG
|
9 | NA | Bradykinin | Bradykinin | 12559981#Cleary DB, Ehringer WD, Maurer MC#Establishing the inhibitory effects of bradykinin on thrombin#Arch Biochem Biophys 2003 Feb 1;410(1):96-106 | |
NP00805 |
RPPGSPFR
|
8 | NA | Bradykinin | Bradykinin | 9606729#Ottleben H, Haasemann M, Ramachandran R, Müller-Esterl W, Brown LR#NMR investigations of recombinant 15N/13C/2H-labeled bradykinin bound to a Fab mimic of the B2 receptor#Receptors Channels 1997;5(3-4):237-41 | |
NP00817 |
SCNTATCVTHRLAGLLSRLGGVVKSNFVPTNVGSQAF
|
37 | NA | Calcitonin | Calcitonin gene-related peptide | 1417824#Miyata A, Jiang L, Minamino N, Arimura A#Identification of calcitonin gene related peptide in ovine hypothalamic extract#Biochem Biophys Res Commun 1992 Sep 30;187(3):1474-9 | |
NP01227 |
EPYLRF
|
6 | NA | FMRFamide related peptide | EPYLRFamide | 12609746#Pivovarov AS, Walker RJ#EPYLRFamide-mediated reduction of acetylcholine-induced inward currents in Helix lucorum-identified neurones: role of NAADP-dependent and IP3-dependent Ca2+ release from internal stores, calmodulin and Ca2+/calmodulin-dependent protein kinase II#Regul Pept 2003 Mar 28;111(1-3):31-9 | |
NP01228 |
FMLF
|
4 | NA | FMRFamide related peptide | FMRFamide | 9622030#Heyliger SO, Payza K, Rothman RB#The effect of FMRFamide analogs on [35S]GTP-gamma-S stimulation in squid optic lobes#Peptides 1998;19(4):739-47 | |
NP01229 |
XDYGHMRF
|
8 | NA | FMRFamide related peptide | FMRFamide-related peptide | 12747944#Duttlinger A, Mispelon M, Nichols R#The structure of the FMRFamide receptor and activity of the cardioexcitatory neuropeptide are conserved in mosquito#Neuropeptides 2003 Apr;37(2):120-6 | |
NP01230 |
SIKPSAYLPLRF
|
12 | NA | FMRFamide related peptide | Gonadotropin-inhibitory hormone | 17901228#Ubuka T, Kim S, Huang YC, Reid J, Jiang J, Osugi T, Chowdhury VS, Tsutsui K, Bentley GE#Gonadotropin-inhibitory hormone neurons interact directly with gonadotropin-releasing hormone-I and -II neurons in European starling brain#Endocrinology 2008 Jan;149(1):268-78 | |
NP01231 |
SWGAPAEKFWMRAMPQRF
|
18 | NA | FMRFamide related peptide | RFamide | 16623709#Osugi T, Ukena K, Sower SA, Kawauchi H, Tsutsui K#Evolutionary origin and divergence of PQRFamide peptides and LPXRFamide peptides in the RFamide peptide family#Insights from novel lamprey RFamide peptides FEBS J 2006 Apr;273(8):1731-43 | |
NP01232 |
YGGFMKKKFMRF
|
12 | NA | FMRFamide related peptide | YFamde | 19560378#Vats ID, Snehlata, Nath M, Pasha MA, Pasha S#Effect of chronic intra-peritoneally administered chimeric peptide of met-enkephalin and FMRFa-[D-Ala2]YFa-on antinociception and opioid receptor regulation#Eur J Pain 2010 Mar;14(3):295e1-9 | |
NP01526 |
SSIQSLLNLPQRF
|
13 | NA | FMRFamide related peptide | Gonadotropin inhibitory hormone-related peptide 2 | 22045661#Ubuka T, Inoue K, Fukuda Y, Mizuno T, Ukena K, Kriegsfeld LJ, Tsutsui K#Identification, expression, and physiological functions of Siberian hamster gonadotropin-inhibitory hormone#Endocrinology 2012 Jan;153(1):373-85 | |
NP01527 |
SIKPFANLPLRF
|
12 | NA | FMRFamide related peptide | Gonadotropin-inhibitory hormone | 22045661#Ubuka T, Inoue K, Fukuda Y, Mizuno T, Ukena K, Kriegsfeld LJ, Tsutsui K#Identification, expression, and physiological functions of Siberian hamster gonadotropin-inhibitory hormone#Endocrinology 2012 Jan;153(1):373-85 | |
NP01528 |
AMAHLPLRLGKNREDSLSRWVPNLPQRF
|
28 | NA | FMRFamide related peptide | RFamide-related peptide-3 | 22045661#Ubuka T, Inoue K, Fukuda Y, Mizuno T, Ukena K, Kriegsfeld LJ, Tsutsui K#Identification, expression, and physiological functions of Siberian hamster gonadotropin-inhibitory hormone#Endocrinology 2012 Jan;153(1):373-85 | |
NP01529 |
SGRNMEVSLVRQVLNLPQRF
|
20 | NA | FMRFamide related peptide | RFamide-related peptide-3 | 22045661#Ubuka T, Inoue K, Fukuda Y, Mizuno T, Ukena K, Kriegsfeld LJ, Tsutsui K#Identification, expression, and physiological functions of Siberian hamster gonadotropin-inhibitory hormone#Endocrinology 2012 Jan;153(1):373-85 | |
NP02046 |
YMGWMDF
|
7 | NA | Gastrin/cholecystokinin | Cholecystokinin | 6737428#Penke B, Hajnal F, Lonovics J, Holzinger G, Kadar T, Telegdy G, Rivier J#Synthesis of potent heptapeptide analogues of cholecystokinin#J Med Chem 1984 Jul;27(7):845-9 | |
NP02047 |
WMDF
|
4 | NA | Gastrin/cholecystokinin | Cholecystokinin 4 | 11044801#Verspohl EJ, LaMura M#Biological effects of newly synthesized cholecystokinin analogs#Horm Res 2000;53(4):177-84 | |
NP02048 |
GWMDF
|
5 | NA | Gastrin/cholecystokinin | Cholecystokinin 5 | 3814577#Chérot P, Fournié-Zaluski MC, Laval J#Purification and characterization of an enkephalin-degrading dipeptidyl-aminopeptidase from porcine brain#Biochemistry 1986 Dec 16;25(25):8184-91 | |
NP02049 |
AVQKVDGESRAHLGALLARYIQQARKAPSGRVSMIKNLQSLDPSHRISDRDYMGWMDF
|
58 | NA | Gastrin/cholecystokinin | Cholecystokinin-58 | 6468664#Tatemoto K, Jörnvall H, Siimesmaa S, Halldén G, Mutt V#Isolation and characterization of cholecystokinin-58 (CCK-58) from porcine brain#FEBS Lett 1984 Sep 3;174(2):289-93 | |
NP02050 |
VPSSAGQLKPIQRLDGNVDQKANIGALLAKYLQQARKGPTGRISMMGNRVQNIDPTHRINDRDYMGWMD
|
69 | NA | Gastrin/cholecystokinin | Cholecystokinin-70 | 7925386#Johnsen AH#Identification of cholecystokinin from frog and turtle#Divergence of cholecystokinin and gastrin occurred before the evolution of amphibia Eur J Biochem 1994 Sep 1;224(2):691-702 | |
NP02051 |
DLLEALSQDQKLLMAKFLPHIYAELANREGNWHEDAALRPLHDHDYPGWMDF
|
52 | NA | Gastrin/cholecystokinin | Gastrin | 1633800#Johnsen AH, Rehfeld JF#Identification of cholecystokinin/gastrin peptides in frog and turtle#Evidence that cholecystokinin is phylogenetically older than gastrin Eur J Biochem 1992 Jul 15;207(2):419-28 | |
NP02279 |
YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL
|
44 | NA | Glucagon | Growth hormone-releasing factor | 6418166#Böhlen P, Esch F, Brazeau P, Ling N, Guillemin R#Isolation and characterization of the porcine hypothalamic growth hormone releasing factor#Biochem Biophys Res Commun 1983 Oct 31;116(2):726-34 | |
NP02280 |
HADGVFTSDFSRLLGQLSAKKYLESLI
|
27 | NA | Glucagon | Peptide HI | 6947244#Tatemoto K, Mutt V#Isolation and characterization of the intestinal peptide porcine PHI (PHI-27), a new member of the glucagon--secretin family#Proc Natl Acad Sci U S A 1981 Nov;78(11):6603-7 | |
NP02528 |
CHWSYGLRPG
|
10 | NA | GnRH | GnRH | 16483697#Earl ER, Waterston MM, Aughey E, Harvey MJ, Matschke C, Colston A, Ferro VA#Evaluation of two GnRH-I based vaccine formulations on the testes function of entire Suffolk cross ram lambs#Vaccine 2006 Apr 12;24(16):3172-83 | |
NP02529 |
EHSYGLSPG
|
9 | NA | GnRH | GnRH | 9100286#Powell JF, Standen EM, Carolsfeld J, Borella MI, Gazola R, Fischer WH, Park M, Craig AG, Warby CM, Rivier JE, Val-Sella MV, Sherwood NM#Primary structure of three forms of gonadotropin-releasing hormone (GnRH) from the pacu brain#Regul Pept 1997 Feb 26;68(3):189-95 | |
NP02530 |
EHWSHGWLPG
|
10 | NA | GnRH | GnRH | 1631133#Lovejoy DA, Fischer WH, Ngamvongchon S, Craig AG, Nahorniak CS, Peter RE, Rivier JE, Sherwood NM#Distinct sequence of gonadotropin-releasing hormone (GnRH) in dogfish brain provides insight into GnRH evolution#Proc Natl Acad Sci U S A 1992 Jul 15;89(14):6373-7 | |
NP02531 |
EHYSLEWKPG
|
10 | NA | GnRH | GnRH | 3514603#Sherwood NM, Sower SA, Marshak DR, Fraser BA, Brownstein MJ#Primary structure of gonadotropin-releasing hormone from lamprey brain#J Biol Chem 1986 Apr 15;261(11):4812-9 | |
NP02532 |
EHSHGWYPG
|
9 | NA | GnRH | GnRH II | 11493674#Millar R, Lowe S, Conklin D, Pawson A, Maudsley S, Troskie B, Ott T, Millar M, Lincoln G, Sellar R, Faurholm B, Scobie G, Kuestner R, Terasawa E, Katz A#A novel mammalian receptor for the evolutionarily conserved type II GnRH#Proc Natl Acad Sci U S A 2001 Aug 14;98(17):9636-41 | |
NP02533 |
EHWSGLRPG
|
9 | NA | GnRH | GnRH II | 16179411#Barnett DK, Bunnell TM, Millar RP, Abbott DH#Gonadotropin-releasing hormone II stimulates female sexual behavior in marmoset monkeys#Endocrinology 2006 Jan;147(1):615-23 | |
NP02534 |
QHWSHGWFPG
|
10 | NA | GnRH | GnRH-II | 18436713#Kavanaugh SI, Nozaki M, Sower SA#Origins of gonadotropin-releasing hormone (GnRH) in vertebrates: identification of a novel GnRH in a basal vertebrate, the sea lamprey#Endocrinology 2008 Aug;149(8):3860-9 | |
NP02838 |
YNWNSFGLRY
|
10 | NA | KISS1 | Kisspeptin | 20301214#Nielsen SB, Franzmann M, Basaiawmoit RV, Wimmer R, Mikkelsen JD, Otzen DE#beta-Sheet aggregation of kisspeptin-10 is stimulated by heparin but inhibited by amphiphiles#Biopolymers 2010 Aug;93(8):678-89 | |
NP02839 |
YRWNSFGLRY
|
10 | NA | KISS1 | Kisspeptpin | 23040060#Magee C, Bruemmer JE, Nett TM, Squires EL, Clay CM#Kisspeptide in the estrous mare: is it an appropriate ovulation-inducing agent? Theriogenology#2012 Dec;78(9):1987-96 | |
NP02984 |
FVPIFTHSELQKIREKERNKIRNKGQ
|
26 | NA | Motilin | Motilin | 3988845#Reeve JR Jr, Ho FJ, Walsh JH, Ben-Avram CM, Shively JE#Rapid high-yield purification of canine intestinal motilin and its complete sequence determination#J Chromatogr 1985 Mar 15;321(2):421-32 | |
NP03138 |
LSAL
|
4 | NA | NA | 5-HT moduline | 12642380#Murdoch R, Morecroft I, MacLean MR#5-HT moduline: an endogenous inhibitor of 5-HT(1B/1D)-mediated contraction in pulmonary arteries#Br J Pharmacol 2003 Mar;138(5):795-800 | |
NP03139 |
QVTFSRDWNA
|
10 | NA | NA | AKH/corazonin-related peptide | 20068045#Hansen KK, Stafflinger E, Schneider M, Hauser F, Cazzamali G, Williamson M, Kollmann M, Schachtner J, Grimmelikhuijzen CJ#Discovery of a novel insect neuropeptide signaling system closely related to the insect adipokinetic hormone and corazonin hormonal systems#J Biol Chem 2010 Apr 2;285(14):10736-47 | |
NP03140 |
WAGGDASGE
|
9 | NA | NA | Delta sleep-inducing peptide | 21262293#Mikhaleva II, Prudchenko IA, Ivanov VT, Voitenkov VB#JmjC-domain-containing histone demethylases of the JMJD1B type as putative precursors of endogenous DSIP#Peptides 2011 Apr;32(4):826-31 | |
NP03141 |
EPPGGSKVILF
|
11 | NA | NA | Head Activator | 12592026#Lai JR, Gellman SH#Reinvestigation of the proposed folding and self-association of the Neuropeptide Head Activator#Protein Sci 2003 Mar;12(3):560-6 | |
NP03142 |
GIGAVLKVLTTGLPALISWIKRKRQQ
|
26 | NA | NA | Melittin | 7488630#Midoux P, Mayer R, Monsigny M#Membrane permeabilization by alpha-helical peptides: a flow cytometry study#Biochim Biophys Acta 1995 Nov 1;1239(2):249-56 | |
NP03143 |
NAPVSIPQ
|
8 | NA | NA | neuropeptide NAP | 21757007#Greggio S, de Paula S, de Oliveira IM, Trindade C, Rosa RM, Henriques JA, DaCosta JC#NAP prevents acute cerebral oxidative stress and protects against long-term brain injury and cognitive impairment in a model of neonatal hypoxia-ischemia#Neurobiol Dis 2011 Oct;44(1):152-9 | |
NP03144 |
MYECG
|
5 | NA | NA | Nontoxic neuropeptide | 16732619#Vaher M, Viirlaid S, Ehrlich K, Mahlapuu R, Jarvet J, Soomets U, Kaljurand M#Characterization of the antioxidative activity of novel nontoxic neuropeptides by using capillary electrophoresis#Electrophoresis 2006 Jul;27(13):2582-9 | |
NP03145 |
FISDQSRRKDLSDRPLPE
|
18 | NA | NA | NPQ 53-70 | 22038051#Toll L, Khroyan TV, Sonmez K, Ozawa A, Lindberg I, McLaughlin JP, Eans SO, Shahien AA, Kapusta DR#Peptides derived from the prohormone proNPQ/spexin are potent central modulators of cardiovascular and renal function and nociception#FASEB J 2012 Feb;26(2):947-54 | |
NP03146 |
QATVGDVNTDRPGLLDLK
|
18 | NA | NA | Octadecaneuropeptide ODN | 16493464#Patteux C, Foucout L, Bohn P, Dupas G, Leprince J, Tonon MC, Dehouck B, Marsais F, Papamicaël C, Levacher V#Solid phase synthesis of a redox delivery system with the aim of targeting peptides into the brain#Org Biomol Chem 2006 Mar 7;4(5):817-25 | |
NP03147 |
RPGLLDLK
|
8 | NA | NA | Octapeptide OP | 16493464#Patteux C, Foucout L, Bohn P, Dupas G, Leprince J, Tonon MC, Dehouck B, Marsais F, Papamicaël C, Levacher V#Solid phase synthesis of a redox delivery system with the aim of targeting peptides into the brain#Org Biomol Chem 2006 Mar 7;4(5):817-25 | |
NP03148 |
NWTPQAMLYLKGAQ
|
14 | NA | NA | Spexin | 22038051#Toll L, Khroyan TV, Sonmez K, Ozawa A, Lindberg I, McLaughlin JP, Eans SO, Shahien AA, Kapusta DR#Peptides derived from the prohormone proNPQ/spexin are potent central modulators of cardiovascular and renal function and nociception#FASEB J 2012 Feb;26(2):947-54 | |
NP03149 |
TKPR
|
4 | NA | NA | tuftsin | 1711198#Semion IZ, Nawrocka E, Słoń J, Tartar A, Obuchowicz E, Gołba K, Herman ZS#Antinociceptive action of the SP1-4 tetrapeptide and of some tuftsin analogs#Pol J Pharmacol Pharm 1990 Jul-Aug;42(4):393-401 | |
NP03150 |
YPWG
|
4 | NA | NA | Tyr-W-MIF-1 | 17343845#Nakayama D, Watanabe C, Watanabe H, Mizoguchi H, Sakurada T, Sakurada S#A Tyr-W-MIF-1 analog containing D-Pro2 discriminates among antinociception in mice mediated by different classes of mu-opioid receptors#Eur J Pharmacol 2007 Jun 1;563(1-3):109-16 | |
NP03742 |
WYKPAAGHSSYSVGRAAGLLSGL
|
23 | NA | Neuropeptide B/W | Neuropeptide B | 15918679#Lucyk S, Miskolzie M, Kotovych G#NMR conformational analyses on (des-bromo) neuropeptide B [1-23] and neuropeptide W [1-23]: the importance of alpha-helices, a cation-pi interaction and a beta-turn#J Biomol Struct Dyn 2005 Aug;23(1):77-90 | |
NP03761 |
SDSEEEMKALEADLLTNMHT
|
20 | NA | Neurotensin | neuromedin N | 1883359#Carraway RE, Mitra SP#Purification of large neuromedin N (NMN) from canine intestine and its identification as NMN-125#Biochem Biophys Res Commun 1991 Aug 30;179(1):301-8 | |
NP03762 |
RRPYIL
|
6 | NA | Neurotensin | Neurotensin | 1623301#Doulut S, Rodriguez M, Lugrin D, Vecchini F, Kitabgi P, Aumelas A, Martinez J#Reduced peptide bond pseudopeptide analogues of neurotensin#Pept Res 1992 Jan-Feb;5(1):30-8 | |
NP04041 |
MEHFRWG
|
7 | NA | Opioid | ACTH4-10 | 10358199#Getting SJ, Gibbs L, Clark AJ, Flower RJ, Perretti M#POMC gene-derived peptides activate melanocortin type 3 receptor on murine macrophages, suppress cytokine release, and inhibit neutrophil migration in acute experimental inflammation#J Immunol 1999 Jun 15;162(12):7446-53 | |
NP04042 |
SYMEHFRWGKPV
|
12 | NA | Opioid | Alpha-melanocyte-stimulating hormone | 8558511#Haskell-Luevano C, Miwa H, Dickinson C, Hadley ME, Hruby VJ, Yamada T, Gantz I#Characterizations of the unusual dissociation properties of melanotropin peptides from the melanocortin receptor, hMC1R#J Med Chem 1996 Jan 19;39(2):432-5 | |
NP04043 |
SYSMEHFRWGKPV
|
13 | NA | Opioid | Alpha-melanocyte-stimulating hormone | 12063121#Desai P, Prachand M, Coutinho E, Saran A, Bodi J, Süli-Vargha H#Activity and conformation of a cyclic heptapeptide possessing the message sequence His-Phe-Arg-Trp of alpha-melanotropin#Int J Biol Macromol 2002 Jun 18;30(3-4):187-95 | |
NP04044 |
YAGFL
|
5 | NA | Opioid | DADLE | 10406217#Bak A, Siahaan TJ, Gudmundsson OS, Gangwar S, Friis GJ, Borchardt RT#Synthesis and evaluation of the physicochemical properties of esterase-sensitive cyclic prodrugs of opioid peptides using an (acyloxy)alkoxy linker#J Pept Res 1999 Apr;53(4):393-402 | |
NP04045 |
YAFEVVG
|
7 | NA | Opioid | Deltorphin II | 8394911#Kramer TH, Davis P, Hruby VJ, Burks TF, Porreca F#In vitro potency, affinity and agonist efficacy of highly selective delta opioid receptor ligands#J Pharmacol Exp Ther 1993 Aug;266(2):577-84 | |
NP04046 |
YGGFLRRIRPKLKWDNE
|
17 | NA | Opioid | Dynorphin A(1-17) | 8907503#Alford DR, Renugopalakrishnan V, Duzgunes N#Dynorphin-phospholipid membrane interactions: role of phospholipid head-group and cholesterol#Int J Pept Protein Res 1996 Jan-Feb;47(1-2):84-90 | |
NP04047 |
YPW/FF
|
4 | NA | Opioid | Endomorphin | 17276550#Yu Y, Shao X, Wang CL, Liu HM, Cui Y, Fan YZ, Liu J, Wang R#In vitro and in vivo characterization of opioid activities of endomorphins analogs with novel constrained C-terminus: evidence for the important role of proper spatial disposition of the third aromatic ring#Peptides 2007 Apr;28(4):859-70 | |
NP04048 |
YPFF
|
4 | NA | Opioid | Endomorphin-2 | 17492626#Greenwell TN, Martin-Schild S, Inglis FM, Zadina JE#Colocalization and shared distribution of endomorphins with substance P, calcitonin gene-related peptide, gamma-aminobutyric acid, and the mu opioid receptor#J Comp Neurol 2007 Jul 10;503(2):319-33 | |
NP04049 |
APGPR
|
5 | NA | Opioid | Enterostatin | 18304696#Takenaka Y, Shimano T, Yamada Y, Yoshida M, Ohinata K, Yoshikawa M#Enterostatin (APGPR) suppresses the analgesic activity of morphine by a CCK-dependent mechanism#Peptides 2008 Apr;29(4):559-63 | |
NP04050 |
YGFL
|
4 | NA | Opioid | Leu-enkephalin | 1540207#Slaoui-Hasnaoui A, Guerin MC, Torreilles J#Reciprocal effects between opioid peptides and human polymorphonuclear leukocytes--I#Chemical modifications of Leu-enkephalin by phorbol myristate acetate-stimulated polymorphonuclear leukocytes Biochem Pharmacol 1992 Feb 4;43(3):497-502 | |
NP04051 |
LVVYPWTQRY
|
10 | NA | Opioid | Leu-Val-Val-hemorphin-7 | 14499287#Hayakari M, Satoh K, Izumi H, Kudoh T, Asano J, Yamazaki T, Tsuchida S#Kinetic-controlled hydrolysis of Leu-Val-Val-hemorphin-7 catalyzed by angiotensin-converting enzyme from rat brain#Peptides 2003 Jul;24(7):1075-82 | |
NP04052 |
VVYPWTQRF
|
9 | NA | Opioid | VV-hemorphin 7 | 11237710#Szikra J, Benyhe S, Orosz G, Darula Z, Piot JM, Fruitier I, Monory K, Hanoune J, Borsodi A#Radioligand binding properties of VV-hemorphin 7, an atypical opioid peptide#Biochem Biophys Res Commun 2001 Mar 2;281(3):670-7 | |
NP04954 |
TSFTPRL
|
7 | NA | Pyrokinin | Leucopyrokinin | 9437758#Plech A, Rykaczewska-Czerwińska M, Bartosz-Bechowski H, Lombarska-Sliwińska D, Małota M, Szewczyk M, Brus R, Konopińska D#Insect neuropeptide leucopyrokinin analogues--synthesis and antinociceptive effect in rats#Pol J Pharmacol 1997 Mar-Jun;49(2-3):119-26 | |
NP05227 |
SEEPPISLDLTFHLLRELEMARAEQLAQQAHSNRKLMENF
|
40 | NA | Sauvagine/corticotropin-releasing factor/urotensin I | Corticotropin-releasing factor | 3010325#Patthy M, Schlesinger DH, Horvath J, Mason-Garcia M, Szoke B, Schally AV#Purification and characterization of peptides with corticotropin-releasing factor activity from porcine hypothalami#Proc Natl Acad Sci U S A 1986 May;83(9):2969-73 | |
NP05260 |
NRVYIHPFHL
|
10 | NA | Serpin | Angiotensin I | 11606206#Laurent V, Brooks DR, Coates D, Isaac RE#Functional expression and characterization of the cytoplasmic aminopeptidase P of Caenorhabditis elegans#Eur J Biochem 2001 Oct;268(20):5430-8 | |
NP05261 |
DRVYHPF
|
7 | NA | Serpin | Angiotensin II | 8515427#Plucinska K, Kataoka T, Yodo M, Cody WL, He JX, Humblet C, Lu GH, Lunney E, Major TC, Panek RL, et al#Multiple binding modes for the receptor-bound conformations of cyclic AII agonists#J Med Chem 1993 Jun 25;36(13):1902-13 | |
NP05262 |
DRVYIHPF
|
8 | NA | Serpin | Angiotensin II | 22707160#Stutzman JR, Luongo CA, McLuckey SA#Covalent and non-covalent binding in the ion/ion charge inversion of peptide cations with benzene-disulfonic acid anions#J Mass Spectrom 2012 Jun;47(6):669-75 | |
NP05263 |
DRVYIHPFHL
|
10 | NA | Serpin | Angiotensin II | 9149430#Kerwin JL#Profiling peptide adducts of oxidized N-acetyldopamine by electrospray mass spectrometry#Rapid Commun Mass Spectrom 1997;11(6):557-66 | |
NP05264 |
DRVYVHPF
|
8 | NA | Serpin | Angiotensin II | 20226387#Gan R, Furuzawa S, Kojima T, Kanie K, Kato R, Okochi M, Honda H, Nakano H#Directed evolution of angiotensin II-inhibiting peptides using a microbead display#J Biosci Bioeng 2010 Apr;109(4):411-7 | |
NP05265 |
DRVYVIHPF
|
9 | NA | Serpin | Angiotensin II | 8363604#Nikiforovich GV, Marshall GR#Three-dimensional recognition requirements for angiotensin agonists: a novel solution for an old problem#Biochem Biophys Res Commun 1993 Aug 31;195(1):222-8 | |
NP05266 |
EEDYDERPYMQPF
|
13 | NA | Serpin | Angiotensin II | 21220408#Wong MK, Takei Y#Characterization of a native angiotensin from an anciently diverged serine protease inhibitor in lamprey#J Endocrinol 2011 Apr;209(1):127-37 | |
NP05267 |
NRVYVHPF
|
8 | NA | Serpin | Angiotensin II | 21220408#Wong MK, Takei Y#Characterization of a native angiotensin from an anciently diverged serine protease inhibitor in lamprey#J Endocrinol 2011 Apr;209(1):127-37 | |
NP05268 |
RVYVHPF
|
7 | NA | Serpin | Angiotensin II | 214562#Escher EH, Nguyen TM, Robert H, St-Pierre SA, Regoli DC#Photoaffinity labeling of the angiotensin II receptor#1 Synthesis and biological activities of the labeling peptides J Med Chem 1978 Sep;21(9):860-4 | |
NP05269 |
RVYIHPF
|
7 | NA | Serpin | Angiotensin III | 15053674#Tsaprailis G, Nair H, Zhong W, Kuppannan K, Futrell JH, Wysocki VH#A mechanistic investigation of the enhanced cleavage at histidine in the gas-phase dissociation of protonated peptides#Anal Chem 2004 Apr 1;76(7):2083-94 | |
NP05270 |
VYIHPF
|
6 | NA | Serpin | Angiotensin IV | 21476495#Andersson H, Demaegdt H, Johnsson A, Vauquelin G, Lindeberg G, Hallberg M, Erdelyi M, Karlen A, Hallberg A#Potent macrocyclic inhibitors of insulin-regulated aminopeptidase (IRAP) by olefin ring-closing metathesis#J Med Chem 2011 Jun 9;54(11):3779-92 | |
NP05366 |
PCKNFFWKTFSSCK
|
14 | NA | Somastostatin | Cortistatin | 12030609#Cassoni P, Muccioli G, Marrocco T, Volante M, Allia E, Ghigo E, Deghenghi R, Papotti M#Cortistatin-14 inhibits cell proliferation of human thyroid carcinoma cell lines of both follicular and parafollicular origin#J Endocrinol Invest 2002 Apr;25(4):362-8 | |
NP05367 |
SANSNPAMAPRERKAGCKNFFWKTFTSC
|
28 | NA | Somastostatin | Somatostatin-28 | 6109284#Esch F, Böhlen P, Ling N, Benoit R, Brazeau P, Guillemin R#Primary structure of ovine hypothalamic somatostatin-28 and somatostatin-25#Proc Natl Acad Sci U S A 1980 Nov;77(11):6827-31 | |
NP05368 |
SVDSTNNLPPRERKAGCKNFYWXGFTSC
|
28 | NA | Somastostatin | Somatostatin-28 | 2863928#Spiess J, Noe BD#Anglerfish pancreatic islets produce two forms of somatostatin-28#Adv Exp Med Biol 1985;188:141-54 | |
NP05533 |
EPSKDAFIGLM
|
11 | NA | Tachykinin | Eledoisin | 21472584#Li X, Huang Y, O'Connor PB, Lin C#Structural heterogeneity of doubly-charged peptide b-ions#J Am Soc Mass Spectrom 2011 Feb;22(2):245-54 | |
NP05534 |
EADPNKFYGLM
|
11 | NA | Tachykinin | Physalaemin | 2428402#Chassaing G, Convert O, Lavielle S#Conformational analogy between substance P and physalaemin#Biochim Biophys Acta 1986 Oct 17;873(3):397-404 | |
NP05805 |
GPPSECFWKYCV
|
12 | NA | Urotensin-2 | Urotensin II | 10548501#Mori M, Sugo T, Abe M, Shimomura Y, Kurihara M, Kitada C, Kikuchi K, Shintani Y, Kurokawa T, Onda H, Nishimura O, Fujino M#Urotensin II is the endogenous ligand of a G-protein-coupled orphan receptor, SENR (GPR14)#Biochem Biophys Res Commun 1999 Nov;265(1):123-9 | |
NP05806 |
GPTSECFWKYCV
|
12 | NA | Urotensin-2 | Urotensin II | 10548501#Mori M, Sugo T, Abe M, Shimomura Y, Kurihara M, Kitada C, Kikuchi K, Shintani Y, Kurokawa T, Onda H, Nishimura O, Fujino M#Urotensin II is the endogenous ligand of a G-protein-coupled orphan receptor, SENR (GPR14)#Biochem Biophys Res Commun 1999 Nov;265(1):123-9 | |
NP05818 |
ENCCPRG
|
7 | NA | Vasopressin/oxytocin | Arginine vasopressin (AVP)(4-9) | 12646291#Mishima K, Tsukikawa H, Miura I, Inada K, Abe K, Matsumoto Y, Egashira N, Iwasaki K, Fujiwara M#Ameliorative effect of NC-1900, a new AVP4-9 analog, through vasopressin V1A receptor on scopolamine-induced impairments of spatial memory in the eight-arm radial maze#Neuropharmacology 2003 Mar;44(4):541-52 | |
NP05819 |
CYFQNCPRG
|
9 | NA | Vasopressin/oxytocin | vasopressin | 16610789#Slusarz MJ, Sikorska E, Slusarz R, Ciarkowski J#Molecular docking-based study of vasopressin analogues modified at positions 2 and 3 with N-methylphenylalanine: influence on receptor-bound conformations and interactions with vasopressin and oxytocin receptors#J Med Chem 2006 Apr 20;49(8):2463-9 |