Total number of results for Galleria mellonella are 14
Download
as Fasta All
| NPID | Sequence | Length | Organism | Family | Name | PMID | Peptide_REF |
|---|---|---|---|---|---|---|---|
| NP00401 | SRPYLFGL |
8 | Galleria mellonella | Allatostatin | Bom-AST-3 | 15706623#Huybrechts J, Verleyen P, Schoofs L#Mass spectrometric analysis of head ganglia and neuroendocrine tissue of larval Galleria mellonella (Arthropoda, Insecta)#J Mass Spectrom 2005 Feb;40(2):271-6 | |
| NP00402 | ARPYSFGL |
8 | Galleria mellonella | Allatostatin | Bom-AST-4 | 15706623#Huybrechts J, Verleyen P, Schoofs L#Mass spectrometric analysis of head ganglia and neuroendocrine tissue of larval Galleria mellonella (Arthropoda, Insecta)#J Mass Spectrom 2005 Feb;40(2):271-6 | |
| NP00403 | LSSKFNFGL |
9 | Galleria mellonella | Allatostatin | Bom-AST-7 | 15706623#Huybrechts J, Verleyen P, Schoofs L#Mass spectrometric analysis of head ganglia and neuroendocrine tissue of larval Galleria mellonella (Arthropoda, Insecta)#J Mass Spectrom 2005 Feb;40(2):271-6 | |
| NP00404 | SRPYSFGL |
8 | Galleria mellonella | Allatostatin | Hea-AST-7 | 15706623#Huybrechts J, Verleyen P, Schoofs L#Mass spectrometric analysis of head ganglia and neuroendocrine tissue of larval Galleria mellonella (Arthropoda, Insecta)#J Mass Spectrom 2005 Feb;40(2):271-6 | |
| NP00405 | SPHYDFGL |
8 | Galleria mellonella | Allatostatin | Helicostatin-1 | 15706623#Huybrechts J, Verleyen P, Schoofs L#Mass spectrometric analysis of head ganglia and neuroendocrine tissue of larval Galleria mellonella (Arthropoda, Insecta)#J Mass Spectrom 2005 Feb;40(2):271-6 | |
| NP01070 | QTFQYSRGWTN |
11 | Galleria mellonella | Corazonin | Corazonin | 11520357#Hansen I.A., Sehnal F., Meyer S.R., Scheller K.; #Corazonin gene expression in the waxmoth Galleria mellonella.; #Insect Mol. Biol. 10:341-346(2001). | |
| NP01071 | DGHKTEDIRDLTNNLERILSPCQMNKLKYVLEGKPLNERLLGPCDTSKTRSTTNPSDTNTSAVKTPCSTHFNKHCYSFSY |
80 | Galleria mellonella | Corazonin | Corazonin precursor-related peptide | ||
| NP01072 | QTFQYSRGWTNGKRDGHKTEDIRDLTNNLERILSPCQMNKLKYVLEGKPLNERLLGPCDTSKTRSTTNPSDTNTSAVKTPCSTHFNKHCYSFSY |
94 | Galleria mellonella | Corazonin | Pro-corazonin (Potential) | ||
| NP01474 | GNSFLRF |
7 | Galleria mellonella | FMRFamide related peptide | FLRFamide II | 15706623#Huybrechts J, Verleyen P, Schoofs L#Mass spectrometric analysis of head ganglia and neuroendocrine tissue of larval Galleria mellonella (Arthropoda, Insecta)#J Mass Spectrom 2005 Feb;40(2):271-6 | |
| NP01475 | AMVRF |
5 | Galleria mellonella | FMRFamide related peptide | Gam-Neuropeptide F | 15706623#Huybrechts J, Verleyen P, Schoofs L#Mass spectrometric analysis of head ganglia and neuroendocrine tissue of larval Galleria mellonella (Arthropoda, Insecta)#J Mass Spectrom 2005 Feb;40(2):271-6 | |
| NP02811 | YFSPWG |
6 | Galleria mellonella | Kinin | Hez-kinin-1 | 15706623#Huybrechts J, Verleyen P, Schoofs L#Mass spectrometric analysis of head ganglia and neuroendocrine tissue of larval Galleria mellonella (Arthropoda, Insecta)#J Mass Spectrom 2005 Feb;40(2):271-6 | |
| NP02812 | VRFSPWG |
7 | Galleria mellonella | Kinin | Hez-kinin-2 | 15706623#Huybrechts J, Verleyen P, Schoofs L#Mass spectrometric analysis of head ganglia and neuroendocrine tissue of larval Galleria mellonella (Arthropoda, Insecta)#J Mass Spectrom 2005 Feb;40(2):271-6 | |
| NP03063 | QDVVHSFLRF |
10 | Galleria mellonella | Myosuppressin | Myosuppressin | 15706623#Huybrechts J, Verleyen P, Schoofs L#Mass spectrometric analysis of head ganglia and neuroendocrine tissue of larval Galleria mellonella (Arthropoda, Insecta)#J Mass Spectrom 2005 Feb;40(2):271-6 | |
| NP04968 | VIFTPKL |
7 | Galleria mellonella | Pyrokinin | Alpha-SG neuropeptide | 15706623#Huybrechts J, Verleyen P, Schoofs L#Mass spectrometric analysis of head ganglia and neuroendocrine tissue of larval Galleria mellonella (Arthropoda, Insecta)#J Mass Spectrom 2005 Feb;40(2):271-6 |