Total number of results for Caenorhabditis elegans are 226
Download
as Fasta All
| NPID | Sequence | Length | Organism | Family | Name | PMID | Peptide_REF |
|---|---|---|---|---|---|---|---|
| NP01157 | AGSDPNFLRFG |
11 | Caenorhabditis elegans | FMRFamide related peptide | FLP-1 | 1607945#Rosoff ML, Bürglin TR, Li C#Alternatively spliced transcripts of the flp-1 gene encode distinct FMRFamide-like peptides in Caenorhabditis elegans#J Neurosci 1992 Jun;12(6):2356-61 | |
| NP01158 | FMRF |
4 | Caenorhabditis elegans | FMRFamide related peptide | FMRFamide | 15236235#Kim K, Li C#Expression and regulation of an FMRFamide-related neuropeptide gene family in Caenorhabditis elegans#J Comp Neurol 2004 Aug 2;475(4):540-50 | |
| NP01159 | KNNKFEFIRF |
10 | Caenorhabditis elegans | FMRFamide related peptide | FMRFamide-like peptide | 19843350#Johnston MJ, McVeigh P, McMaster S, Fleming CC, Maule AG#FMRFamide-like peptides in root knot nematodes and their potential role in nematode physiology#J Helminthol 2010 Sep;84(3):253-65 | |
| NP01160 | SADPNFLRFG |
10 | Caenorhabditis elegans | FMRFamide related peptide | FMRFamide-like peptide | 1607945#Rosoff ML, Bürglin TR, Li C#Alternatively spliced transcripts of the flp-1 gene encode distinct FMRFamide-like peptides in Caenorhabditis elegans#J Neurosci 1992 Jun;12(6):2356-61 | |
| NP01161 | ADDGAPLIRF |
10 | Caenorhabditis elegans | FMRFamide related peptide | FMRFamide-related peptide | 11527423#Marks NJ, Shaw C, Halton DW, Thompson DP, Geary TG, Li C, Maule AG#Isolation and preliminary biological assessment of AADGAPLIRFamide and SVPGVLRFamide from Caenorhabditis elegans#Biochem Biophys Res Commun 2001 Sep 7;286(5):1170-6 | |
| NP01162 | GFGDEMSMPGVLRF |
14 | Caenorhabditis elegans | FMRFamide related peptide | Neuropeptide AF10 | 11087928#Reinitz CA, Herfel HG, Messinger LA, Stretton AO#Changes in locomotory behavior and cAMP produced in Ascaris suum by neuropeptides from Ascaris suum or Caenorhabditis elegans#Mol Biochem Parasitol 2000 Nov;111(1):185-97 | |
| NP01163 | FDRDFMHF |
8 | Caenorhabditis elegans | FMRFamide related peptide | Neuropeptide AF17 | 11087928#Reinitz CA, Herfel HG, Messinger LA, Stretton AO#Changes in locomotory behavior and cAMP produced in Ascaris suum by neuropeptides from Ascaris suum or Caenorhabditis elegans#Mol Biochem Parasitol 2000 Nov;111(1):185-97 | |
| NP01320 | SDPNFLRFG |
9 | Caenorhabditis elegans | FMRFamide related peptide | FLP-1 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
| NP01321 | SQPNFLRFG |
9 | Caenorhabditis elegans | FMRFamide related peptide | FLP-1 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
| NP01322 | AMRNALVRFG |
10 | Caenorhabditis elegans | FMRFamide related peptide | FLP-11 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
| NP01323 | NGAPQPFVRFG |
11 | Caenorhabditis elegans | FMRFamide related peptide | FLP-11 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
| NP01324 | RNKFEFIRF |
9 | Caenorhabditis elegans | FMRFamide related peptide | FLP-12 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP01325 | AADGAPFIRF |
10 | Caenorhabditis elegans | FMRFamide related peptide | FLP-13 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP01326 | APEASPFIRFG |
11 | Caenorhabditis elegans | FMRFamide related peptide | FLP-13 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
| NP01327 | ASPSAPFIRF |
10 | Caenorhabditis elegans | FMRFamide related peptide | FLP-13 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP01328 | ASSAPFIRF |
9 | Caenorhabditis elegans | FMRFamide related peptide | FLP-13 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP01329 | ASSAPLIRFGR |
11 | Caenorhabditis elegans | FMRFamide related peptide | FLP-13 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
| NP01330 | SAAAPLIRFG |
10 | Caenorhabditis elegans | FMRFamide related peptide | FLP-13 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
| NP01331 | SPSAVPFIRF |
10 | Caenorhabditis elegans | FMRFamide related peptide | FLP-13 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP01332 | SPSAVPLIRFG |
11 | Caenorhabditis elegans | FMRFamide related peptide | FLP-13 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
| NP01333 | GGPQGPLRF |
9 | Caenorhabditis elegans | FMRFamide related peptide | FLP-15 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP01334 | GGPQGPLRFG |
10 | Caenorhabditis elegans | FMRFamide related peptide | FLP-15 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
| NP01335 | RGPSGPLRF |
9 | Caenorhabditis elegans | FMRFamide related peptide | FLP-15 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP01336 | DFDGAMPGVLRF |
12 | Caenorhabditis elegans | FMRFamide related peptide | FLP-18 | 18760316#Husson SJ, Landuyt B, Nys T, Baggerman G, Boonen K, Clynen E, Lindemans M, Janssen T, Schoofs L#Comparative peptidomics of Caenorhabditis elegans versus C#briggsae by LC-MALDI-TOF MS Peptides 2009 Mar;30(3):449-57 | |
| NP01337 | DFDGAMPGVLRFG |
13 | Caenorhabditis elegans | FMRFamide related peptide | FLP-18 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
| NP01338 | EMPGVLRFG |
9 | Caenorhabditis elegans | FMRFamide related peptide | FLP-18 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
| NP01339 | SVPGVLRFG |
9 | Caenorhabditis elegans | FMRFamide related peptide | FLP-18 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
| NP01340 | ASWASSVRF |
9 | Caenorhabditis elegans | FMRFamide related peptide | FLP-19 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP01341 | WANQVRFG |
8 | Caenorhabditis elegans | FMRFamide related peptide | FLP-19 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
| NP01342 | LRGEPIRFG |
9 | Caenorhabditis elegans | FMRFamide related peptide | FLP-2 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
| NP01343 | AMMRFG |
6 | Caenorhabditis elegans | FMRFamide related peptide | FLP-20 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
| NP01344 | GLGPRPLRF |
9 | Caenorhabditis elegans | FMRFamide related peptide | FLP-21 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP01345 | SPREPIRF |
8 | Caenorhabditis elegans | FMRFamide related peptide | FLP-2-1 | 20806053#Jarecki JL, Andersen K, Konop CJ, Knickelbine JJ, Vestling MM, Stretton AO#Mapping neuropeptide expression by mass spectrometry in single dissected identified neurons from the dorsal ganglion of the nematode Ascaris suum#ACS Chem Neurosci 2010 Jul 21;1(7):505-519 | |
| NP01346 | SPSAKWMRF |
9 | Caenorhabditis elegans | FMRFamide related peptide | FLP-22 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP01347 | SPSAKWMRFG |
10 | Caenorhabditis elegans | FMRFamide related peptide | FLP-22 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
| NP01348 | VPSAGDMMVRFG |
12 | Caenorhabditis elegans | FMRFamide related peptide | FLP-24 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
| NP01349 | ASYDYIRF |
8 | Caenorhabditis elegans | FMRFamide related peptide | FLP-25 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP01350 | DYDFVRF |
7 | Caenorhabditis elegans | FMRFamide related peptide | FLP-25 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP01351 | DYDFVRFG |
8 | Caenorhabditis elegans | FMRFamide related peptide | FLP-25 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
| NP01352 | EFNADDLTLRFG |
12 | Caenorhabditis elegans | FMRFamide related peptide | FLP-26 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
| NP01353 | FRLPFQFFGANEDFNSGLT |
19 | Caenorhabditis elegans | FMRFamide related peptide | FLP-26 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
| NP01354 | GGAGEPLAFSPDMLSLRFG |
19 | Caenorhabditis elegans | FMRFamide related peptide | FLP-26 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
| NP01355 | APNRVLMRF |
9 | Caenorhabditis elegans | FMRFamide related peptide | FLP-28 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP01356 | APNRVLMRFG |
10 | Caenorhabditis elegans | FMRFamide related peptide | FLP-28 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
| NP01357 | VLMRFG |
6 | Caenorhabditis elegans | FMRFamide related peptide | FLP-28 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
| NP01358 | ASEDALFGTMRFG |
13 | Caenorhabditis elegans | FMRFamide related peptide | FLP-3 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
| NP01359 | NPLGTMRFG |
9 | Caenorhabditis elegans | FMRFamide related peptide | FLP-3 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
| NP01360 | AMRNSLVRF |
9 | Caenorhabditis elegans | FMRFamide related peptide | FLP-32 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP01361 | APLEGFEDMSGFLRTIDGIQKPRF |
24 | Caenorhabditis elegans | FMRFamide related peptide | FLP-33 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP01362 | ASPSFIRF |
8 | Caenorhabditis elegans | FMRFamide related peptide | FLP-4 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP01363 | AGAKFIRFG |
9 | Caenorhabditis elegans | FMRFamide related peptide | FLP-5 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
| NP01364 | APKPKFIRFG |
10 | Caenorhabditis elegans | FMRFamide related peptide | FLP-5 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
| NP01365 | KSAYMRFG |
8 | Caenorhabditis elegans | FMRFamide related peptide | FLP-6 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
| NP01366 | SPMQRSSMVRFG |
12 | Caenorhabditis elegans | FMRFamide related peptide | FLP-7 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
| NP01367 | TPMQRSSMVRFG |
12 | Caenorhabditis elegans | FMRFamide related peptide | FLP-7 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
| NP01368 | SPMQRSSMVRF |
11 | Caenorhabditis elegans | FMRFamide related peptide | FLP-7-1 | 20806053#Jarecki JL, Andersen K, Konop CJ, Knickelbine JJ, Vestling MM, Stretton AO#Mapping neuropeptide expression by mass spectrometry in single dissected identified neurons from the dorsal ganglion of the nematode Ascaris suum#ACS Chem Neurosci 2010 Jul 21;1(7):505-519 | |
| NP01369 | TPMQRSSMVRF |
11 | Caenorhabditis elegans | FMRFamide related peptide | FLP-7-2 | 20806053#Jarecki JL, Andersen K, Konop CJ, Knickelbine JJ, Vestling MM, Stretton AO#Mapping neuropeptide expression by mass spectrometry in single dissected identified neurons from the dorsal ganglion of the nematode Ascaris suum#ACS Chem Neurosci 2010 Jul 21;1(7):505-519 | |
| NP01370 | SPMERSAMVRF |
11 | Caenorhabditis elegans | FMRFamide related peptide | FLP-7-3 | 20806053#Jarecki JL, Andersen K, Konop CJ, Knickelbine JJ, Vestling MM, Stretton AO#Mapping neuropeptide expression by mass spectrometry in single dissected identified neurons from the dorsal ganglion of the nematode Ascaris suum#ACS Chem Neurosci 2010 Jul 21;1(7):505-519 | |
| NP01371 | SPMDRSKMVRF |
11 | Caenorhabditis elegans | FMRFamide related peptide | FLP-7-4 | 20806053#Jarecki JL, Andersen K, Konop CJ, Knickelbine JJ, Vestling MM, Stretton AO#Mapping neuropeptide expression by mass spectrometry in single dissected identified neurons from the dorsal ganglion of the nematode Ascaris suum#ACS Chem Neurosci 2010 Jul 21;1(7):505-519 | |
| NP01372 | KNEFIRF |
7 | Caenorhabditis elegans | FMRFamide related peptide | FLP-8 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP01373 | LRGEPIRF |
8 | Caenorhabditis elegans | FMRFamide related peptide | FMRFamide-like peptide | 20806053#Jarecki JL, Andersen K, Konop CJ, Knickelbine JJ, Vestling MM, Stretton AO#Mapping neuropeptide expression by mass spectrometry in single dissected identified neurons from the dorsal ganglion of the nematode Ascaris suum#ACS Chem Neurosci 2010 Jul 21;1(7):505-519 | |
| NP01374 | GAMPGVLRF |
9 | Caenorhabditis elegans | FMRFamide related peptide | FMRFamide-related peptide | 16061202#Husson SJ, Clynen E, Baggerman G, De Loof A, Schoofs L#Discovering neuropeptides in Caenorhabditis elegans by two dimensional liquid chromatography and mass spectrometry#Biochem Biophys Res Commun 2005 Sep 16;335(1):76-86 | |
| NP01375 | SYFDEKKSVPGVLRF |
15 | Caenorhabditis elegans | FMRFamide related peptide | FMRFamide-related peptide | 16061202#Husson SJ, Clynen E, Baggerman G, De Loof A, Schoofs L#Discovering neuropeptides in Caenorhabditis elegans by two dimensional liquid chromatography and mass spectrometry#Biochem Biophys Res Commun 2005 Sep 16;335(1):76-86 | |
| NP01376 | AVPGVLRF |
8 | Caenorhabditis elegans | FMRFamide related peptide | Neuropeptide AF3 | 12865086#Moffett CL, Beckett AM, Mousley A, Geary TG, Marks NJ, Halton DW, Thompson DP, Maule AG#The ovijector of Ascaris suum: multiple response types revealed by Caenorhabditis elegans FMRFamide-related peptides#Int J Parasitol 2003 Jul 30;33(8):859-76 | |
| NP01377 | GDVPGVLRF |
9 | Caenorhabditis elegans | FMRFamide related peptide | Neuropeptide AF4 | 12865086#Moffett CL, Beckett AM, Mousley A, Geary TG, Marks NJ, Halton DW, Thompson DP, Maule AG#The ovijector of Ascaris suum: multiple response types revealed by Caenorhabditis elegans FMRFamide-related peptides#Int J Parasitol 2003 Jul 30;33(8):859-76 | |
| NP01378 | KPNFIRF |
7 | Caenorhabditis elegans | FMRFamide related peptide | Neuropeptide PF4 | 12865086#Moffett CL, Beckett AM, Mousley A, Geary TG, Marks NJ, Halton DW, Thompson DP, Maule AG#The ovijector of Ascaris suum: multiple response types revealed by Caenorhabditis elegans FMRFamide-related peptides#Int J Parasitol 2003 Jul 30;33(8):859-76 | |
| NP01379 | FNADDLTLRF |
10 | Caenorhabditis elegans | FMRFamide related peptide | Novel FaRP | 16061202#Husson SJ, Clynen E, Baggerman G, De Loof A, Schoofs L#Discovering neuropeptides in Caenorhabditis elegans by two dimensional liquid chromatography and mass spectrometry#Biochem Biophys Res Commun 2005 Sep 16;335(1):76-86 | |
| NP01621 | AAADPNFLRF |
10 | Caenorhabditis elegans | FMRFamide related peptide | AAADPNFLRF-amide | 8483810# Rosoff M.L., Doble K.E., Price D.A., Li C.; #The flp-1 propeptide is processed into multiple, highly similar FMRFamide-like peptides in Caenorhabditis elegans.; # Peptides 14:331-338(1993).$16061202#Husson S.J., Clynen E., Baggerman G., De Loof A., Schoofs L.; #Discovering neuropeptides in Caenorhabditis elegans by two dimensional liquid chromatography and mass spectrometry.; #Biochem. Biophys. Res. Commun. 335:76-86(2005). | |
| NP01622 | AGSDPNFLRF |
10 | Caenorhabditis elegans | FMRFamide related peptide | AGSDPNFLRF-amide | 8483810#Rosoff M.L., Doble K.E., Price D.A., Li C.; #The flp-1 propeptide is processed into multiple, highly similar FMRFamide-like peptides in Caenorhabditis elegans.; #Peptides 14:331-338(1993). | |
| NP01623 | ASGDPNFLRF |
10 | Caenorhabditis elegans | FMRFamide related peptide | ASGDPNFLRF-amide | 8483810#Rosoff M.L., Doble K.E., Price D.A., Li C.; #The flp-1 propeptide is processed into multiple, highly similar FMRFamide-like peptides in Caenorhabditis elegans.; #Peptides 14:331-338(1993). | |
| NP01624 | SDPNFLRF |
8 | Caenorhabditis elegans | FMRFamide related peptide | Neuropeptide PF1 | 8483810#Rosoff M.L., Doble K.E., Price D.A., Li C.; #The flp-1 propeptide is processed into multiple, highly similar FMRFamide-like peptides in Caenorhabditis elegans.; #Peptides 14:331-338(1993). | |
| NP01625 | PNFLRF |
6 | Caenorhabditis elegans | FMRFamide related peptide | PNFLRF-amide | 8483810#Rosoff M.L., Doble K.E., Price D.A., Li C.; #The flp-1 propeptide is processed into multiple, highly similar FMRFamide-like peptides in Caenorhabditis elegans.; #Peptides 14:331-338(1993). | |
| NP01626 | PNFMRY |
6 | Caenorhabditis elegans | FMRFamide related peptide | PNFMRY-amide | 8483810#Rosoff M.L., Doble K.E., Price D.A., Li C.; #The flp-1 propeptide is processed into multiple, highly similar FMRFamide-like peptides in Caenorhabditis elegans.; #Peptides 14:331-338(1993). | |
| NP01627 | SADPNFLRF |
9 | Caenorhabditis elegans | FMRFamide related peptide | SADPNFLRF-amide | 8483810# Rosoff M.L., Doble K.E., Price D.A., Li C.; #The flp-1 propeptide is processed into multiple, highly similar FMRFamide-like peptides in Caenorhabditis elegans.; # Peptides 14:331-338(1993).$16061202#Husson S.J., Clynen E., Baggerman G., De Loof A., Schoofs L.; #Discovering neuropeptides in Caenorhabditis elegans by two dimensional liquid chromatography and mass spectrometry.; #Biochem. Biophys. Res. Commun. 335:76-86(2005). | |
| NP01628 | SQPNFLRF |
8 | Caenorhabditis elegans | FMRFamide related peptide | SQPNFLRF-amide | 8483810#Rosoff M.L., Doble K.E., Price D.A., Li C.; #The flp-1 propeptide is processed into multiple, highly similar FMRFamide-like peptides in Caenorhabditis elegans.; #Peptides 14:331-338(1993). | |
| NP01629 | ASEDALFGTMRF |
12 | Caenorhabditis elegans | FMRFamide related peptide | ASEDALFGTMRF-amide | 16061202#Husson S.J., Clynen E., Baggerman G., De Loof A., Schoofs L.; #Discovering neuropeptides in Caenorhabditis elegans by two dimensional liquid chromatography and mass spectrometry.; #Biochem. Biophys. Res. Commun. 335:76-86(2005). | |
| NP01630 | EAEEPLGTMRF |
11 | Caenorhabditis elegans | FMRFamide related peptide | EAEEPLGTMRF-amide | 16061202#Husson S.J., Clynen E., Baggerman G., De Loof A., Schoofs L.; #Discovering neuropeptides in Caenorhabditis elegans by two dimensional liquid chromatography and mass spectrometry.; #Biochem. Biophys. Res. Commun. 335:76-86(2005). | |
| NP01631 | NPENDTPFGTMRF |
13 | Caenorhabditis elegans | FMRFamide related peptide | NPENDTPFGTMRF-amide | 16061202#Husson S.J., Clynen E., Baggerman G., De Loof A., Schoofs L.; #Discovering neuropeptides in Caenorhabditis elegans by two dimensional liquid chromatography and mass spectrometry.; #Biochem. Biophys. Res. Commun. 335:76-86(2005). | |
| NP01632 | NPLGTMRF |
8 | Caenorhabditis elegans | FMRFamide related peptide | NPLGTMRF-amide (Potential) | ||
| NP01633 | SADDSAPFGTMRF |
13 | Caenorhabditis elegans | FMRFamide related peptide | SADDSAPFGTMRF-amide | 16061202#Husson S.J., Clynen E., Baggerman G., De Loof A., Schoofs L.; #Discovering neuropeptides in Caenorhabditis elegans by two dimensional liquid chromatography and mass spectrometry.; #Biochem. Biophys. Res. Commun. 335:76-86(2005). | |
| NP01634 | SAEPFGTMRF |
10 | Caenorhabditis elegans | FMRFamide related peptide | SAEPFGTMRF-amide | 16061202#Husson S.J., Clynen E., Baggerman G., De Loof A., Schoofs L.; #Discovering neuropeptides in Caenorhabditis elegans by two dimensional liquid chromatography and mass spectrometry.; #Biochem. Biophys. Res. Commun. 335:76-86(2005). | |
| NP01635 | SPLGTMRF |
8 | Caenorhabditis elegans | FMRFamide related peptide | SPLGTMRF-amide (Potential) | ||
| NP01636 | TPLGTMRF |
8 | Caenorhabditis elegans | FMRFamide related peptide | TPLGTMRF-amide | 16061202#Husson S.J., Clynen E., Baggerman G., De Loof A., Schoofs L.; #Discovering neuropeptides in Caenorhabditis elegans by two dimensional liquid chromatography and mass spectrometry.; #Biochem. Biophys. Res. Commun. 335:76-86(2005). | |
| NP01637 | AGAKFIRF |
8 | Caenorhabditis elegans | FMRFamide related peptide | AGAKFIRF-amide | ||
| NP01638 | APKPKFIRF |
9 | Caenorhabditis elegans | FMRFamide related peptide | APKPKFIRF-amide (Potential) | ||
| NP01639 | GAKFIRF |
7 | Caenorhabditis elegans | FMRFamide related peptide | GAKFIRF-amide | 16061202#Husson S.J., Clynen E., Baggerman G., De Loof A., Schoofs L.; #Discovering neuropeptides in Caenorhabditis elegans by two dimensional liquid chromatography and mass spectrometry.; #Biochem. Biophys. Res. Commun. 335:76-86(2005). | |
| NP01640 | KSAYMRF |
7 | Caenorhabditis elegans | FMRFamide related peptide | KSAYMRF-amide 1 | 9675153#Marks N.J., Maule A.G., Geary T.G., Thompson D.P., Li C., Halton D.W., Shaw C.; #KSAYMRFamide (PF3/AF8) is present in the free-living nematode, Caenorhabditis elegans.; #Biochem. Biophys. Res. Commun. 248:422-425(1998). | |
| NP01641 | QQDSEVEREMM |
11 | Caenorhabditis elegans | FMRFamide related peptide | QQDSEVEREMM | 16061202#Husson S.J., Clynen E., Baggerman G., De Loof A., Schoofs L.; #Discovering neuropeptides in Caenorhabditis elegans by two dimensional liquid chromatography and mass spectrometry.; #Biochem. Biophys. Res. Commun. 335:76-86(2005). | |
| NP01642 | KPSFVRF |
7 | Caenorhabditis elegans | FMRFamide related peptide | KPSFVRF-amide 1 | 9920762# Marks N.J., Maule A.G., Li C., Nelson L.S., Thompson D.P., Alexander-Bowman S., Geary T.G., Halton D.W., Verhaert P., Shaw C.; #Isolation, pharmacology and gene organization of KPSFVRFamide: a neuropeptide from Caenorhabditis elegans.; # Biochem. Biophys. Res. Commun. 254:222-230(1999).$16061202#Husson S.J., Clynen E., Baggerman G., De Loof A., Schoofs L.; #Discovering neuropeptides in Caenorhabditis elegans by two dimensional liquid chromatography and mass spectrometry.; #Biochem. Biophys. Res. Commun. 335:76-86(2005). | |
| NP01643 | AMRNALVRF |
9 | Caenorhabditis elegans | FMRFamide related peptide | AMRNALVRF-amide (Potential) | ||
| NP01644 | ASGGMRNALVRF |
12 | Caenorhabditis elegans | FMRFamide related peptide | ASGGMRNALVRF-amide | 16061202#Husson S.J., Clynen E., Baggerman G., De Loof A., Schoofs L.; #Discovering neuropeptides in Caenorhabditis elegans by two dimensional liquid chromatography and mass spectrometry.; #Biochem. Biophys. Res. Commun. 335:76-86(2005). | |
| NP01645 | NGAPQPFVRF |
10 | Caenorhabditis elegans | FMRFamide related peptide | Neuropeptide AF22 | 16061202#Husson S.J., Clynen E., Baggerman G., De Loof A., Schoofs L.; #Discovering neuropeptides in Caenorhabditis elegans by two dimensional liquid chromatography and mass spectrometry.; #Biochem. Biophys. Res. Commun. 335:76-86(2005). | |
| NP01646 | SPLDEEDFAPESPLQ |
15 | Caenorhabditis elegans | FMRFamide related peptide | SPLDEEDFAPESPLQ-amide | 16061202#Husson S.J., Clynen E., Baggerman G., De Loof A., Schoofs L.; #Discovering neuropeptides in Caenorhabditis elegans by two dimensional liquid chromatography and mass spectrometry.; #Biochem. Biophys. Res. Commun. 335:76-86(2005). | |
| NP01647 | AADGAPLIRF |
10 | Caenorhabditis elegans | FMRFamide related peptide | AADGAPLIRF-amide 1 | 16061202# Husson S.J., Clynen E., Baggerman G., De Loof A., Schoofs L.; #Discovering neuropeptides in Caenorhabditis elegans by two dimensional liquid chromatography and mass spectrometry.; # Biochem. Biophys. Res. Commun. 335:76-86(2005).$11527423#Marks N.J., Shaw C., Halton D.W., Thompson D.P., Geary T.G., Li C., Maule A.G.; #Isolation and preliminary biological assessment of AADGAPLIRFamide and SVPGVLRFamide from Caenorhabditis elegans.; #Biochem. Biophys. Res. Commun. 286:1170-1176(2001). | |
| NP01648 | AMDSPLIRF |
9 | Caenorhabditis elegans | FMRFamide related peptide | AMDSPLIRF-amide | 16061202#Husson S.J., Clynen E., Baggerman G., De Loof A., Schoofs L.; #Discovering neuropeptides in Caenorhabditis elegans by two dimensional liquid chromatography and mass spectrometry.; #Biochem. Biophys. Res. Commun. 335:76-86(2005). | |
| NP01649 | APEASPFIRF |
10 | Caenorhabditis elegans | FMRFamide related peptide | APEASPFIRF-amide 2 | 16061202# Husson S.J., Clynen E., Baggerman G., De Loof A., Schoofs L.; #Discovering neuropeptides in Caenorhabditis elegans by two dimensional liquid chromatography and mass spectrometry.; # Biochem. Biophys. Res. Commun. 335:76-86(2005).$9070852#Marks N.J., Maule A.G., Geary T.G., Thompson D.P., Davis J.P., Halton D.W., Verhaert P., Shaw C.; #APEASPFIRFamide, a novel FMRFamide-related decapeptide from Caenorhabditis elegans: structure and myoactivity.; #Biochem. Biophys. Res. Commun. 231:591-595(1997). | |
| NP01650 | ASPSAPLIRF |
10 | Caenorhabditis elegans | FMRFamide related peptide | ASPSAPLIRF-amide | 16061202#Husson S.J., Clynen E., Baggerman G., De Loof A., Schoofs L.; #Discovering neuropeptides in Caenorhabditis elegans by two dimensional liquid chromatography and mass spectrometry.; #Biochem. Biophys. Res. Commun. 335:76-86(2005). | |
| NP01651 | ASSAPLIRF |
9 | Caenorhabditis elegans | FMRFamide related peptide | ASSAPLIRF-amide (Potential) | ||
| NP01652 | SAAAPLIRF |
9 | Caenorhabditis elegans | FMRFamide related peptide | SAAAPLIRF-amide | 16061202#Husson S.J., Clynen E., Baggerman G., De Loof A., Schoofs L.; #Discovering neuropeptides in Caenorhabditis elegans by two dimensional liquid chromatography and mass spectrometry.; #Biochem. Biophys. Res. Commun. 335:76-86(2005). | |
| NP01653 | SDRPTRAMDSPLIRF |
15 | Caenorhabditis elegans | FMRFamide related peptide | SDRPTRAMDSPLIRF-amide (Potential) | ||
| NP01654 | SPSAVPLIRF |
10 | Caenorhabditis elegans | FMRFamide related peptide | SPSAVPLIRF-amide | 16061202#Husson S.J., Clynen E., Baggerman G., De Loof A., Schoofs L.; #Discovering neuropeptides in Caenorhabditis elegans by two dimensional liquid chromatography and mass spectrometry.; #Biochem. Biophys. Res. Commun. 335:76-86(2005). | |
| NP01655 | KHEYLRF |
7 | Caenorhabditis elegans | FMRFamide related peptide | Neuropeptide AF2 | 8554607#Marks N.J., Shaw C., Maule A.G., Davis J.P., Halton D.W., Verhaert P., Geary T.G., Thompson D.P.; #Isolation of AF2 (KHEYLRFamide) from Caenorhabditis elegans: evidence for the presence of more than one FMRFamide-related peptide-encoding gene.; #Biochem. Biophys. Res. Commun. 217:845-851(1995). | |
| NP01656 | AQTFVRF |
7 | Caenorhabditis elegans | FMRFamide related peptide | AQTFVRF-amide 1 | 16061202#Husson S.J., Clynen E., Baggerman G., De Loof A., Schoofs L.; #Discovering neuropeptides in Caenorhabditis elegans by two dimensional liquid chromatography and mass spectrometry.; #Biochem. Biophys. Res. Commun. 335:76-86(2005). | |
| NP01657 | GQTFVRF |
7 | Caenorhabditis elegans | FMRFamide related peptide | GQTFVRF-amide | 16061202#Husson S.J., Clynen E., Baggerman G., De Loof A., Schoofs L.; #Discovering neuropeptides in Caenorhabditis elegans by two dimensional liquid chromatography and mass spectrometry.; #Biochem. Biophys. Res. Commun. 335:76-86(2005). | |
| NP01658 | DVPGVLRF |
8 | Caenorhabditis elegans | FMRFamide related peptide | DVPGVLRF-amide | ||
| NP01659 | EIPGVLRF |
8 | Caenorhabditis elegans | FMRFamide related peptide | EIPGVLRF-amide | ||
| NP01660 | EMPGVLRF |
8 | Caenorhabditis elegans | FMRFamide related peptide | EMPGVLRF-amide | 16187307#Papaioannou S., Marsden D., Franks C.J., Walker R.J., Holden-Dye L.; #Role of a FMRFamide-like family of neuropeptides in the pharyngeal nervous system of Caenorhabditis elegans.; #J. Neurobiol. 65:304-319(2005). | |
| NP01661 | SEVPGVLRF |
9 | Caenorhabditis elegans | FMRFamide related peptide | SEVPGVLRF-amide | ||
| NP01662 | SVPGVLRF |
8 | Caenorhabditis elegans | FMRFamide related peptide | SVPGVLRF-amide 1 | 11527423#Marks N.J., Shaw C., Halton D.W., Thompson D.P., Geary T.G., Li C., Maule A.G.; #Isolation and preliminary biological assessment of AADGAPLIRFamide and SVPGVLRFamide from Caenorhabditis elegans.; #Biochem. Biophys. Res. Commun. 286:1170-1176(2001). | |
| NP01663 | WANQVRF |
7 | Caenorhabditis elegans | FMRFamide related peptide | WANQVRF-amide | 16061202#Husson S.J., Clynen E., Baggerman G., De Loof A., Schoofs L.; #Discovering neuropeptides in Caenorhabditis elegans by two dimensional liquid chromatography and mass spectrometry.; #Biochem. Biophys. Res. Commun. 335:76-86(2005). | |
| NP01664 | VVGQQDFLRF |
10 | Caenorhabditis elegans | FMRFamide related peptide | VVGQQDFLRF-amide (Potential) | ||
| NP01665 | VPSAGDMMVRF |
11 | Caenorhabditis elegans | FMRFamide related peptide | Neuropeptide AF 36 | 16061202#Husson S.J., Clynen E., Baggerman G., De Loof A., Schoofs L.; #Discovering neuropeptides in Caenorhabditis elegans by two dimensional liquid chromatography and mass spectrometry.; #Biochem. Biophys. Res. Commun. 335:76-86(2005). | |
| NP01666 | EFNADDLTLRF |
11 | Caenorhabditis elegans | FMRFamide related peptide | EFNADDLTLRF-amide | 16061202#Husson S.J., Clynen E., Baggerman G., De Loof A., Schoofs L.; #Discovering neuropeptides in Caenorhabditis elegans by two dimensional liquid chromatography and mass spectrometry.; #Biochem. Biophys. Res. Commun. 335:76-86(2005). | |
| NP01667 | GGAGEPLAFSPDMLSLRF |
18 | Caenorhabditis elegans | FMRFamide related peptide | GGAGEPLAFSPDMLSLRF-amide | 16061202#Husson S.J., Clynen E., Baggerman G., De Loof A., Schoofs L.; #Discovering neuropeptides in Caenorhabditis elegans by two dimensional liquid chromatography and mass spectrometry.; #Biochem. Biophys. Res. Commun. 335:76-86(2005). | |
| NP01668 | EASAFGDIIGELKGKGLGGRMRF |
23 | Caenorhabditis elegans | FMRFamide related peptide | EASAFGDIIGELKGKGLGGRMRF-amide | 19456328#Clynen E., Husson S.J., Schoofs L.; #Identification of new members of the (short) neuropeptide F family in locusts and Caenorhabditis elegans.; #Ann. N. Y. Acad. Sci. 1163:60-74(2009). | |
| NP03235 | APKQMVFGF |
9 | Caenorhabditis elegans | NA | Neuropeptide- like protein (NLP) peptide | 16061202#Husson SJ, Clynen E, Baggerman G, De Loof A, Schoofs L#Discovering neuropeptides in Caenorhabditis elegans by two dimensional liquid chromatography and mass spectrometry#Biochem Biophys Res Commun 2005 Sep 16;335(1):76-86 | |
| NP03236 | APGLFELPSRSV |
12 | Caenorhabditis elegans | NA | NLP peptide | 16061202#Husson SJ, Clynen E, Baggerman G, De Loof A, Schoofs L#Discovering neuropeptides in Caenorhabditis elegans by two dimensional liquid chromatography and mass spectrometry#Biochem Biophys Res Commun 2005 Sep 16;335(1):76-86 | |
| NP03237 | YPYLIFPASPSSGDSRRLV |
19 | Caenorhabditis elegans | NA | NLP peptide | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP03238 | MDANAFRMSF |
10 | Caenorhabditis elegans | NA | NLP-1 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP03239 | MDANAFRMSFG |
11 | Caenorhabditis elegans | NA | NLP-1 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
| NP03240 | MDPNAFRMSF |
10 | Caenorhabditis elegans | NA | NLP-1 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP03241 | VNLDPNSFRMSF |
12 | Caenorhabditis elegans | NA | NLP-1 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP03242 | AIPFNGGMYG |
10 | Caenorhabditis elegans | NA | NLP-10 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
| NP03243 | GAMPFSGGMYG |
11 | Caenorhabditis elegans | NA | NLP-10 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
| NP03244 | SGQIFAQ |
7 | Caenorhabditis elegans | NA | NLP-10 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
| NP03245 | SLVPQSYSNNENQI |
14 | Caenorhabditis elegans | NA | NLP-10 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
| NP03246 | STMPFSGGMYG |
11 | Caenorhabditis elegans | NA | NLP-10 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
| NP03247 | HISPSYDVEIDAGNMRNLLDI |
21 | Caenorhabditis elegans | NA | NLP-11 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP03248 | HISPSYDVEIDAGNMRNLLDIG |
22 | Caenorhabditis elegans | NA | NLP-11 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
| NP03249 | SAPMASDYGNQFQMYNRLIDA |
21 | Caenorhabditis elegans | NA | NLP-11 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP03250 | SAPMASDYGNQFQMYNRLIDAG |
22 | Caenorhabditis elegans | NA | NLP-11 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
| NP03251 | SPAISPAYQFENAFGLSEALERAG |
24 | Caenorhabditis elegans | NA | NLP-11 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
| NP03252 | DGYRPLQF |
8 | Caenorhabditis elegans | NA | NLP-12 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP03253 | DYRPLQF |
7 | Caenorhabditis elegans | NA | NLP-12 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP03254 | AEDYERQIMAF |
11 | Caenorhabditis elegans | NA | NLP-13 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP03255 | NDFSRDIMSF |
10 | Caenorhabditis elegans | NA | NLP-13 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP03256 | SAPSDFSRDIMSF |
13 | Caenorhabditis elegans | NA | NLP-13 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP03257 | SAPSDFSRDIMSFG |
14 | Caenorhabditis elegans | NA | NLP-13 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
| NP03258 | SGNTADLYDRRIMAF |
15 | Caenorhabditis elegans | NA | NLP-13 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP03259 | SPVDYDRPIMAF |
12 | Caenorhabditis elegans | NA | NLP-13 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP03260 | SPVDYDRPIMAFG |
13 | Caenorhabditis elegans | NA | NLP-13 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
| NP03261 | SSSMYDRDIMSF |
12 | Caenorhabditis elegans | NA | NLP-13 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP03262 | SSSMYDRDIMSFG |
13 | Caenorhabditis elegans | NA | NLP-13 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
| NP03263 | ALDGLDGAGFGFD |
13 | Caenorhabditis elegans | NA | NLP-14 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP03264 | ALDGLDGSGFGFD |
13 | Caenorhabditis elegans | NA | NLP-14 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP03265 | ALNSLDGAGFGFE |
13 | Caenorhabditis elegans | NA | NLP-14 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP03266 | ALNSLDGNGFGFD |
13 | Caenorhabditis elegans | NA | NLP-14 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP03267 | ALNSLDGQGFGFE |
13 | Caenorhabditis elegans | NA | NLP-14 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP03268 | AAVRLRPVGSLFFLNRPHE |
19 | Caenorhabditis elegans | NA | NLP-15 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
| NP03269 | AFDSLAGQGFTGFE |
14 | Caenorhabditis elegans | NA | NLP-15 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP03270 | AFDSLAGSGFDNGFN |
15 | Caenorhabditis elegans | NA | NLP-15 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP03271 | AFDSLAGSGFGAFN |
14 | Caenorhabditis elegans | NA | NLP-15 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP03272 | AFDSLAGSGFSGFD |
14 | Caenorhabditis elegans | NA | NLP-15 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP03273 | NAEDHHEHQ |
9 | Caenorhabditis elegans | NA | NLP-16 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP03274 | SVDEHHGHQ |
9 | Caenorhabditis elegans | NA | NLP-16 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP03275 | GSLSNMMRI |
9 | Caenorhabditis elegans | NA | NLP-17 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP03276 | ASPYGFAFA |
9 | Caenorhabditis elegans | NA | NLP-18 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP03277 | SDEENLDFLE |
10 | Caenorhabditis elegans | NA | NLP-18 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP03278 | SPYRAFAFA |
9 | Caenorhabditis elegans | NA | NLP-18 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP03279 | SPYRTFAFA |
9 | Caenorhabditis elegans | NA | NLP-18 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP03280 | IGLRLPNML |
9 | Caenorhabditis elegans | NA | NLP-19 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP03281 | FAFA |
4 | Caenorhabditis elegans | NA | NLP-20 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
| NP03282 | SGPQAHEGAGMRFAFA |
16 | Caenorhabditis elegans | NA | NLP-20 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP03283 | GGARAFLTEM |
10 | Caenorhabditis elegans | NA | NLP-21 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP03284 | GGARAFVENS |
10 | Caenorhabditis elegans | NA | NLP-21 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP03285 | GGARAFYDE |
9 | Caenorhabditis elegans | NA | NLP-21 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP03286 | GGARVFQGFEDE |
12 | Caenorhabditis elegans | NA | NLP-21 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP03287 | QYTSELEEDE |
10 | Caenorhabditis elegans | NA | NLP-21 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP03288 | GGFGQQSQFG |
10 | Caenorhabditis elegans | NA | NLP-26 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP03289 | AINPFLDSMG |
10 | Caenorhabditis elegans | NA | NLP-3 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
| NP03290 | AVNPFLDSIG |
10 | Caenorhabditis elegans | NA | NLP-3 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
| NP03291 | ARMMSFDAEAPQYLQHLLQNLKPRF |
25 | Caenorhabditis elegans | NA | NLP-35 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
| NP03292 | AVVSGYDNIYQVLAPRF |
17 | Caenorhabditis elegans | NA | NLP-35 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP03293 | NNAEVVNHILKNFGALDRLGDV |
22 | Caenorhabditis elegans | NA | NLP-37 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP03294 | NNAEVVNHILKNFGALDRLGDVG |
23 | Caenorhabditis elegans | NA | NLP-37 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
| NP03295 | ASDDRVLGWNKAHGLW |
16 | Caenorhabditis elegans | NA | NLP-38 | 18760316#Husson SJ, Landuyt B, Nys T, Baggerman G, Boonen K, Clynen E, Lindemans M, Janssen T, Schoofs L#Comparative peptidomics of Caenorhabditis elegans versus C#briggsae by LC-MALDI-TOF MS Peptides 2009 Mar;30(3):449-57 | |
| NP03296 | SPAQWQRANGLW |
12 | Caenorhabditis elegans | NA | NLP-38 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP03297 | SPAQWQRANGLWG |
13 | Caenorhabditis elegans | NA | NLP-38 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
| NP03298 | TPQNWNKLNSLW |
12 | Caenorhabditis elegans | NA | NLP-38 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP03299 | TPQNWNKLNSLWG |
13 | Caenorhabditis elegans | NA | NLP-38 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
| NP03300 | VLGWNKAHGLWG |
12 | Caenorhabditis elegans | NA | NLP-38 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
| NP03301 | EVPNFQADNVPEAGGRV |
17 | Caenorhabditis elegans | NA | NLP-39 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP03302 | APSAPAGLEEKL |
12 | Caenorhabditis elegans | NA | NLP-40 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
| NP03303 | APSAPAGLEEKLR |
13 | Caenorhabditis elegans | NA | NLP-40 | 18760316#Husson SJ, Landuyt B, Nys T, Baggerman G, Boonen K, Clynen E, Lindemans M, Janssen T, Schoofs L#Comparative peptidomics of Caenorhabditis elegans versus C#briggsae by LC-MALDI-TOF MS Peptides 2009 Mar;30(3):449-57 | |
| NP03304 | APGLFELPSRSVRLI |
15 | Caenorhabditis elegans | NA | NLP-41 | 18760316#Husson SJ, Landuyt B, Nys T, Baggerman G, Boonen K, Clynen E, Lindemans M, Janssen T, Schoofs L#Comparative peptidomics of Caenorhabditis elegans versus C#briggsae by LC-MALDI-TOF MS Peptides 2009 Mar;30(3):449-57 | |
| NP03305 | ALQHFSSLDTLGGMGFG |
17 | Caenorhabditis elegans | NA | NLP-5 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
| NP03306 | SVSQLNQYAGFDTLGGMGL |
19 | Caenorhabditis elegans | NA | NLP-5 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP03307 | SVSQLNQYAGFDTLGGMGLG |
20 | Caenorhabditis elegans | NA | NLP-5 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
| NP03308 | AAMRSFNMGF |
10 | Caenorhabditis elegans | NA | NLP-6 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP03309 | AAMRSFNMGFG |
11 | Caenorhabditis elegans | NA | NLP-6 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
| NP03310 | APKQMVFGFG |
10 | Caenorhabditis elegans | NA | NLP-6 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
| NP03311 | SAEPQIDYEDMSADLEEIPVFIQ |
23 | Caenorhabditis elegans | NA | NLP-6 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
| NP03312 | SMADISDMPEDVPM |
14 | Caenorhabditis elegans | NA | NLP-6 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
| NP03313 | YKPRSFAMGF |
10 | Caenorhabditis elegans | NA | NLP-6 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP03314 | YKPRSFAMGFG |
11 | Caenorhabditis elegans | NA | NLP-6 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
| NP03315 | LYLKQADFDDPRMFTSSF |
18 | Caenorhabditis elegans | NA | NLP-7 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP03316 | LYLKQADFDDPRMFTSSFG |
19 | Caenorhabditis elegans | NA | NLP-7 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
| NP03317 | MILPSLADLHRYTMYD |
16 | Caenorhabditis elegans | NA | NLP-7 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP03318 | QADFDDPRMFTSSF |
14 | Caenorhabditis elegans | NA | NLP-7 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP03319 | SMDDLDDPRLMTMSF |
15 | Caenorhabditis elegans | NA | NLP-7 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP03320 | SMDDLDDPRLMTMSFG |
16 | Caenorhabditis elegans | NA | NLP-7 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
| NP03321 | AFDRFDNSGVFSFGA |
15 | Caenorhabditis elegans | NA | NLP-8 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP03322 | AFDRMDNSDFFGA |
13 | Caenorhabditis elegans | NA | NLP-8 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP03323 | FDRYDDETAYGYGFDNHIF |
19 | Caenorhabditis elegans | NA | NLP-8 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
| NP03324 | SFDRMGGTEFGLM |
13 | Caenorhabditis elegans | NA | NLP-8 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP03325 | DQAAALPYYLYE |
12 | Caenorhabditis elegans | NA | NLP-9 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
| NP03326 | GGGRAFAGSWSPYLERFYDY |
20 | Caenorhabditis elegans | NA | NLP-9 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
| NP03327 | GGGRAFNHNANLFRFD |
16 | Caenorhabditis elegans | NA | NLP-9 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP03328 | TPIAEAQGAPEDVDDRRELE |
20 | Caenorhabditis elegans | NA | NLP-9 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP03521 | SPAISPAYQFENAFGLSEALERA |
23 | Caenorhabditis elegans | NA | Neuropeptide-like peptide 11 | 16061202#Husson S.J., Clynen E., Baggerman G., De Loof A., Schoofs L.; #Discovering neuropeptides in Caenorhabditis elegans by two dimensional liquid chromatography and mass spectrometry.; #Biochem. Biophys. Res. Commun. 335:76-86(2005). | |
| NP03604 | SMVARQIPQTVVADH |
15 | Caenorhabditis elegans | NA | Neuropeptide-like peptide 36 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 $16061202#Husson S.J., Clynen E., Baggerman G., De Loof A., Schoofs L.#Discovering neuropeptides in Caenorhabditis elegans by two dimensional liquid chromatography and mass spectrometry.#Biochem. Biophys. Res. Commun. 335:76-86(2005). | |
| NP03606 | MIEITVNDRLGKKVRIKCNPSDTIGDLKKLIAAQTGTRWEKIVLKKWYTIYKDHITLMDYEIHEGFNFELYYQ |
73 | Caenorhabditis elegans | NA | Ubiquitin-like protein 5 | ||
| NP05929 | GMYGGW |
6 | Caenorhabditis elegans | YGGW-amide related peptide | GMYGGW-amide (Potential) | ||
| NP05930 | GMYGGY |
6 | Caenorhabditis elegans | YGGW-amide related peptide | GMYGGY-amide (Potential) | ||
| NP05931 | GYGGYGGY |
8 | Caenorhabditis elegans | YGGW-amide related peptide | GYGGYGGY-amide (Potential) | ||
| NP05932 | QWGYGGY |
7 | Caenorhabditis elegans | YGGW-amide related peptide | QWGYGGY-amide (Potential) | ||
| NP05933 | RGMW |
4 | Caenorhabditis elegans | YGGW-amide related peptide | GMW-amide (Potential) | ||
| NP05934 | GYGGY |
5 | Caenorhabditis elegans | YGGW-amide related peptide | GYGGY-amide (Potential) | ||
| NP05935 | PYGGYGW |
7 | Caenorhabditis elegans | YGGW-amide related peptide | PYGGYGW-amide (Potential) | ||
| NP05936 | GFYGG |
5 | Caenorhabditis elegans | YGGW-amide related peptide | GFYGG-amide (Potential) | ||
| NP05937 | GGG |
3 | Caenorhabditis elegans | YGGW-amide related peptide | GGG-amide (Potential) | ||
| NP05938 | GGGW |
4 | Caenorhabditis elegans | YGGW-amide related peptide | GGGW-amide (Potential) | ||
| NP05939 | GGGWG |
5 | Caenorhabditis elegans | YGGW-amide related peptide | GGGWG-amide (Potential) | ||
| NP05940 | GGW |
3 | Caenorhabditis elegans | YGGW-amide related peptide | GGW-amide (Potential) | ||
| NP05941 | GYG |
3 | Caenorhabditis elegans | YGGW-amide related peptide | GYG-amide (Potential) | ||
| NP05942 | YGGWG |
5 | Caenorhabditis elegans | YGGW-amide related peptide | YGGWG-amide (Potential) |