Total number of results for Agrotis ipsilon are 5
Download
as Fasta All
| NPID | Sequence | Length | Organism | Family | Name | PMID | Peptide_REF |
|---|---|---|---|---|---|---|---|
| NP05007 | VIFTPKL |
7 | Agrotis ipsilon | Pyrokinin | Alpha-SG neuropeptide (Potential) | ||
| NP05008 | SLSYEDKMFDNVEFTPRL |
18 | Agrotis ipsilon | Pyrokinin | Beta-SG neuropeptide (Potential) | ||
| NP05009 | DVKDGGADRGAHSDRGGMWFGPRI |
24 | Agrotis ipsilon | Pyrokinin | Diapause hormone homolog (Potential) | ||
| NP05010 | TMNFSPRL |
8 | Agrotis ipsilon | Pyrokinin | Gamma-SG neuropeptide (Potential) | ||
| NP05011 | LADDTPATPADQEMYRPDPEQIDSRTKYFSPRL |
33 | Agrotis ipsilon | Pyrokinin | Pheromone biosynthesis-activating neuropeptide |