Total number of results for Aedes aegypti are 75
Download
as Fasta All
| NPID | Sequence | Length | Organism | Family | Name | PMID | Peptide_REF |
|---|---|---|---|---|---|---|---|
| NP00232 | QLTFTPSW |
8 | Aedes aegypti | AKH/HRTH/RPCH | Adipokinetic hormone 1 | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
| NP00236 | SRPYSFGL |
8 | Aedes aegypti | Allatostatin | Allatostatin | 9357049#Veenstra JA, Noriega FG, Graf R, Feyereisen R#Identification of three allatostatins and their cDNA from the mosquito Aedes aegypti#Peptides 1997;18(7):937-42 | |
| NP00270 | SPKYNFGL |
8 | Aedes aegypti | Allatostatin | Allatostatin 1 | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
| NP00271 | LPHYNFGL |
8 | Aedes aegypti | Allatostatin | Allatostatin 2 | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
| NP00272 | ASAYRYHFGL |
10 | Aedes aegypti | Allatostatin | Allatostatin 3 | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
| NP00273 | QIRYRQCYFNPISCF |
15 | Aedes aegypti | Allatostatin | Allatostatin C | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
| NP00274 | RVYDFGL |
7 | Aedes aegypti | Allatostatin | Allatostatin-4 | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
| NP00275 | LPNRYNFGL |
9 | Aedes aegypti | Allatostatin | Allatostatin-5 | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
| NP00276 | VYEDKRLPNRYNFGL |
15 | Aedes aegypti | Allatostatin | AST-5 | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
| NP00277 | TWKNLQGGW |
9 | Aedes aegypti | Allatostatin | MIP-1 | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
| NP00278 | AWNKINGGW |
9 | Aedes aegypti | Allatostatin | MIP-2 | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
| NP00279 | VNAGPAQWNKFRGSW |
15 | Aedes aegypti | Allatostatin | MIP-3 | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
| NP00280 | EPGWNNLKGLW |
11 | Aedes aegypti | Allatostatin | MIP-4b | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
| NP00281 | SEKWNKLSSSW |
11 | Aedes aegypti | Allatostatin | MIP-5 | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
| NP00732 | NSELINSLLSLPKKLNDA |
18 | Aedes aegypti | Arthropod PDH | Pigment-dispersing hormone | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
| NP00860 | TVDFGLSRGYSGAQEAKHRMAMAVANFAGGP |
31 | Aedes aegypti | Calcitonin-like peptide | Diuretic hormone 31 | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
| NP01039 | QTFQYSRGWTN |
11 | Aedes aegypti | Corazonin | Corazonin | ||
| NP01040 | SSPEQTAPSRTLLPHIPLGMDKPDEECRLLIQ |
32 | Aedes aegypti | Corazonin | Corazonin precursor-related peptide | ||
| NP01041 | QTFQYSRGWTNGKRSSPEQTAPSRTLLPHIPLGMDKPDEECRLLIQRFLKSPCDVRLANAIVNRNKDLLRDMADDVNDGTALLYDPVPMVDTAASEDVRFKRGTPDRRLLNDGMHRL |
117 | Aedes aegypti | Corazonin | Pro-corazonin (Potential) | ||
| NP01110 | DETPGFFIKLSKSVPRI |
17 | Aedes aegypti | Ecdysis triggering hormone | Ecdysis triggering hormone-1b | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
| NP01111 | GDFENFFLKQSKSVPRI |
17 | Aedes aegypti | Ecdysis triggering hormone | Ecdysis triggering hormone-2b | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
| NP01146 | FMRF |
4 | Aedes aegypti | FMRFamide related peptide | FMRFamide | 3738889#Brown MR, Crim JW, Lea AO#FMRFamide- and pancreatic polypeptide-like immunoreactivity of endocrine cells in the midgut of a mosquito#Tissue Cell 1986;18(3):419-28 | |
| NP01250 | GYRKPPFNGSIFG |
13 | Aedes aegypti | FMRFamide related peptide | ext SIFa | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
| NP01251 | SALDKNFMRF |
10 | Aedes aegypti | FMRFamide related peptide | FMRFa-1 | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
| NP01252 | SDPRFLRLV |
9 | Aedes aegypti | FMRFamide related peptide | FMRFa-10 | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
| NP01253 | MDNNFMRF |
8 | Aedes aegypti | FMRFamide related peptide | FMRFa-11 | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
| NP01254 | DSPKNLMRF |
9 | Aedes aegypti | FMRFamide related peptide | FMRFa-4 | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
| NP01255 | ANLMRF |
6 | Aedes aegypti | FMRFamide related peptide | FMRFa-6 | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
| NP01256 | GSGNLMRF |
8 | Aedes aegypti | FMRFamide related peptide | FMRFa-8 | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
| NP01257 | ASKQANLMRF |
10 | Aedes aegypti | FMRFamide related peptide | FMRFamide-2 | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
| NP01258 | AGQGFMRF |
8 | Aedes aegypti | FMRFamide related peptide | FMRFamide-3 | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
| NP01259 | DDTNKFLRLS |
10 | Aedes aegypti | FMRFamide related peptide | FMRFamide-5 | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
| NP01260 | AGSEAGGNLQRTNFLRF |
17 | Aedes aegypti | FMRFamide related peptide | FMRFamide-7 | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
| NP01261 | AKGNLMRF |
8 | Aedes aegypti | FMRFamide related peptide | FMRFamide-9 | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
| NP01262 | GYRKPPFNGSIF |
12 | Aedes aegypti | FMRFamide related peptide | SIFamide | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
| NP02060 | FDDYGHMRF |
9 | Aedes aegypti | Gastrin/cholecystokinin | Sulfakinin-1 | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
| NP02061 | GGGGEGEQFDDYGHMRF |
17 | Aedes aegypti | Gastrin/cholecystokinin | Sulfakinin-2 | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
| NP02807 | NTGRVHRQPKVVIRNPFHAWG |
21 | Aedes aegypti | Kinin | Kin-3 | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
| NP02817 | NSKYVSKQKFYSWG |
14 | Aedes aegypti | Kinin | Leucokinin-1 | 8048942#Veenstra J.A.; #Isolation and identification of three leucokinins from the mosquito Aedes aegypti.; #Biochem. Biophys. Res. Commun. 202:715-719(1994). | |
| NP02818 | NPFHAWG |
7 | Aedes aegypti | Kinin | Leucokinin-2 | 8048942#Veenstra J.A.; #Isolation and identification of three leucokinins from the mosquito Aedes aegypti.; #Biochem. Biophys. Res. Commun. 202:715-719(1994). | |
| NP02819 | NNPNVFYPWG |
10 | Aedes aegypti | Kinin | Leucokinin-3 | 8048942#Veenstra J.A.; #Isolation and identification of three leucokinins from the mosquito Aedes aegypti.; #Biochem. Biophys. Res. Commun. 202:715-719(1994). | |
| NP03057 | TDVDHVFLRF |
10 | Aedes aegypti | Myosuppressin | Myosuppressin | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
| NP03175 | APFRNSEMMTARGF |
14 | Aedes aegypti | NA | Allatotropin | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
| NP03176 | NIQSLLRTGMLPSIAPK |
17 | Aedes aegypti | NA | ext NPLP-1-6 | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
| NP03177 | SYRSLLRDGATF |
12 | Aedes aegypti | NA | NPLP-1-1 | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
| NP03178 | NLGSLARAGLLRTPSTDYL |
19 | Aedes aegypti | NA | NPLP-1-2 | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
| NP03179 | NLASARASGYMLN |
13 | Aedes aegypti | NA | NPLP-1-4 | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
| NP03180 | NIASLARKYELP |
12 | Aedes aegypti | NA | NPLP-1-5 | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
| NP03181 | NIQSLLRTGMLPSIAP |
16 | Aedes aegypti | NA | NPLP-1-6 | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
| NP03182 | NMQSLARDNSLPHFAGAAAQES |
22 | Aedes aegypti | NA | NPLP-1-7 | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
| NP03183 | NIQTLVRDWNLPRQQSMAADNE |
22 | Aedes aegypti | NA | NPLP-1-8 | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
| NP03184 | NIQSLKNAQGQGGGSSSG |
18 | Aedes aegypti | NA | NPLP-1-9 | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
| NP03802 | KAVRSPSLRLRF |
12 | Aedes aegypti | NPY | sNPF-1 | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
| NP03803 | SPSLRLRF |
8 | Aedes aegypti | NPY | sNPF-1 4-11 | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
| NP03804 | APQLRLRF |
8 | Aedes aegypti | NPY | sNPF-2 | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
| NP03835 | QRPPSLKTRF |
10 | Aedes aegypti | NPY | Decapeptide 1 | #Matsumoto S., Brown M.R., Crim J.W., Vigna S.R., Lea A.O.; #Isolation and primary structure of neuropeptides from the mosquito, Aedes aegypti, immunoreactive to FMRFamide antiserum.; #Insect Biochem. 19:277-283(1989). | |
| NP03836 | AVRSPSLRLRF |
11 | Aedes aegypti | NPY | RLRF peptide 1 (By similarity) | ||
| NP03837 | SIRAPQLRLRF |
11 | Aedes aegypti | NPY | RLRF peptide 2 (By similarity) | ||
| NP03838 | AIRAPQLRLRF |
11 | Aedes aegypti | NPY | RLRF peptide 3 (By similarity) | ||
| NP03839 | APSQRLRW |
8 | Aedes aegypti | NPY | RLRW peptide (By similarity) | ||
| NP03840 | TDPLWSSFNENALLEE |
16 | Aedes aegypti | NPY | sNPF peptide 2 (By similarity) | ||
| NP03841 | SGGGMFSTNDVMQQ |
14 | Aedes aegypti | NPY | sNPF peptide 3 (By similarity) | ||
| NP03842 | SDPSVPVEPEDDDMVDQ |
17 | Aedes aegypti | NPY | sNPF-associated peptide (By similarity) | ||
| NP04210 | NFDEIDRYSTFG |
12 | Aedes aegypti | Orcokinin | Orcokinin-1 | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
| NP04432 | GPTVGLFAFPRV |
12 | Aedes aegypti | Periviscerokinin | CAPA-Periviscerokinin-1 | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
| NP04433 | QGLVPFPRV |
9 | Aedes aegypti | Periviscerokinin | CAPA-Periviscerokinin-2 | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
| NP04958 | AGNSGANSGMWFGPRL |
16 | Aedes aegypti | Pyrokinin | CAPA-Pyrokinin | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
| NP05003 | AAAMWFGPRL |
10 | Aedes aegypti | Pyrokinin | AAAMWFGPRL-amide (By similarity) | ||
| NP05004 | DASSSNENNSRPPFAPRL |
18 | Aedes aegypti | Pyrokinin | DASSSNENNSRPPFAPRL-amide (By similarity) | ||
| NP05005 | NLPFSPRL |
8 | Aedes aegypti | Pyrokinin | NLPFSPRL-amide (By similarity) | ||
| NP05006 | QPQPVFYHSTTPRL |
14 | Aedes aegypti | Pyrokinin | QPQPVFYHSTTPRL-amide (By similarity) | ||
| NP05545 | VPSGFTGMR |
9 | Aedes aegypti | Tachykinin | Tachykinin-related peptide 2 | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
| NP05546 | VPNGFLGVR |
9 | Aedes aegypti | Tachykinin | Tachykinin-related peptide 5 | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
| NP05547 | APSGFLGLR |
9 | Aedes aegypti | Tachykinin | TKRP-1 and 4 | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
| NP05608 | NTGDKFYGLM |
10 | Aedes aegypti | Tachykinin | Sialokinin | 8278354#Champagne D.E., Ribeiro J.M.C.; #Sialokinin I and II: vasodilatory tachykinins from the yellow fever mosquito Aedes aegypti.; #Proc. Natl. Acad. Sci. U.S.A. 91:138-142(1994). |