Total number of results for Chlorocebus aethiops are 2
Download
as Fasta All
| NPID | Sequence | Length | Organism | Family | Name | PMID | Peptide_REF |
|---|---|---|---|---|---|---|---|
| NP02642 |
FVNQHLCGSHLVEALYLVCGERGFFYTPKT
|
30 | Chlorocebus aethiops | Insulin | Insulin B chain | 4626369#Peterson J.D., Nehrlich S., Oyer P.E., Steiner D.F.#Determination of the amino acid sequence of the monkey, sheep, and dog proinsulin C-peptides by a semi-micro Edman degradation procedure.# J. Biol. Chem. 247:4866-4871(1972). | |
| NP02643 |
GIVEQCCTSICSLYQLENYCN
|
21 | Chlorocebus aethiops | Insulin | Insulin A chain | 4626369#Peterson J.D., Nehrlich S., Oyer P.E., Steiner D.F.#Determination of the amino acid sequence of the monkey, sheep, and dog proinsulin C-peptides by a semi-micro Edman degradation procedure.# J. Biol. Chem. 247:4866-4871(1972). |