Total number of results for Caenorhabditis elegans are 226
Download
as Fasta All
| NPID | Sequence | Length | Organism | Family | Name | PMID | Peptide_REF |
|---|---|---|---|---|---|---|---|
| NP01157 |
AGSDPNFLRFG
|
11 | Caenorhabditis elegans | FMRFamide related peptide | FLP-1 | 1607945#Rosoff ML, Bürglin TR, Li C#Alternatively spliced transcripts of the flp-1 gene encode distinct FMRFamide-like peptides in Caenorhabditis elegans#J Neurosci 1992 Jun;12(6):2356-61 | |
| NP01158 |
FMRF
|
4 | Caenorhabditis elegans | FMRFamide related peptide | FMRFamide | 15236235#Kim K, Li C#Expression and regulation of an FMRFamide-related neuropeptide gene family in Caenorhabditis elegans#J Comp Neurol 2004 Aug 2;475(4):540-50 | |
| NP01159 |
KNNKFEFIRF
|
10 | Caenorhabditis elegans | FMRFamide related peptide | FMRFamide-like peptide | 19843350#Johnston MJ, McVeigh P, McMaster S, Fleming CC, Maule AG#FMRFamide-like peptides in root knot nematodes and their potential role in nematode physiology#J Helminthol 2010 Sep;84(3):253-65 | |
| NP01160 |
SADPNFLRFG
|
10 | Caenorhabditis elegans | FMRFamide related peptide | FMRFamide-like peptide | 1607945#Rosoff ML, Bürglin TR, Li C#Alternatively spliced transcripts of the flp-1 gene encode distinct FMRFamide-like peptides in Caenorhabditis elegans#J Neurosci 1992 Jun;12(6):2356-61 | |
| NP01161 |
ADDGAPLIRF
|
10 | Caenorhabditis elegans | FMRFamide related peptide | FMRFamide-related peptide | 11527423#Marks NJ, Shaw C, Halton DW, Thompson DP, Geary TG, Li C, Maule AG#Isolation and preliminary biological assessment of AADGAPLIRFamide and SVPGVLRFamide from Caenorhabditis elegans#Biochem Biophys Res Commun 2001 Sep 7;286(5):1170-6 | |
| NP01162 |
GFGDEMSMPGVLRF
|
14 | Caenorhabditis elegans | FMRFamide related peptide | Neuropeptide AF10 | 11087928#Reinitz CA, Herfel HG, Messinger LA, Stretton AO#Changes in locomotory behavior and cAMP produced in Ascaris suum by neuropeptides from Ascaris suum or Caenorhabditis elegans#Mol Biochem Parasitol 2000 Nov;111(1):185-97 | |
| NP01163 |
FDRDFMHF
|
8 | Caenorhabditis elegans | FMRFamide related peptide | Neuropeptide AF17 | 11087928#Reinitz CA, Herfel HG, Messinger LA, Stretton AO#Changes in locomotory behavior and cAMP produced in Ascaris suum by neuropeptides from Ascaris suum or Caenorhabditis elegans#Mol Biochem Parasitol 2000 Nov;111(1):185-97 | |
| NP01320 |
SDPNFLRFG
|
9 | Caenorhabditis elegans | FMRFamide related peptide | FLP-1 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
| NP01321 |
SQPNFLRFG
|
9 | Caenorhabditis elegans | FMRFamide related peptide | FLP-1 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
| NP01322 |
AMRNALVRFG
|
10 | Caenorhabditis elegans | FMRFamide related peptide | FLP-11 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
| NP01323 |
NGAPQPFVRFG
|
11 | Caenorhabditis elegans | FMRFamide related peptide | FLP-11 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
| NP01324 |
RNKFEFIRF
|
9 | Caenorhabditis elegans | FMRFamide related peptide | FLP-12 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP01325 |
AADGAPFIRF
|
10 | Caenorhabditis elegans | FMRFamide related peptide | FLP-13 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP01326 |
APEASPFIRFG
|
11 | Caenorhabditis elegans | FMRFamide related peptide | FLP-13 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
| NP01327 |
ASPSAPFIRF
|
10 | Caenorhabditis elegans | FMRFamide related peptide | FLP-13 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP01328 |
ASSAPFIRF
|
9 | Caenorhabditis elegans | FMRFamide related peptide | FLP-13 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP01329 |
ASSAPLIRFGR
|
11 | Caenorhabditis elegans | FMRFamide related peptide | FLP-13 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
| NP01330 |
SAAAPLIRFG
|
10 | Caenorhabditis elegans | FMRFamide related peptide | FLP-13 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
| NP01331 |
SPSAVPFIRF
|
10 | Caenorhabditis elegans | FMRFamide related peptide | FLP-13 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP01332 |
SPSAVPLIRFG
|
11 | Caenorhabditis elegans | FMRFamide related peptide | FLP-13 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
| NP01333 |
GGPQGPLRF
|
9 | Caenorhabditis elegans | FMRFamide related peptide | FLP-15 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP01334 |
GGPQGPLRFG
|
10 | Caenorhabditis elegans | FMRFamide related peptide | FLP-15 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
| NP01335 |
RGPSGPLRF
|
9 | Caenorhabditis elegans | FMRFamide related peptide | FLP-15 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP01336 |
DFDGAMPGVLRF
|
12 | Caenorhabditis elegans | FMRFamide related peptide | FLP-18 | 18760316#Husson SJ, Landuyt B, Nys T, Baggerman G, Boonen K, Clynen E, Lindemans M, Janssen T, Schoofs L#Comparative peptidomics of Caenorhabditis elegans versus C#briggsae by LC-MALDI-TOF MS Peptides 2009 Mar;30(3):449-57 | |
| NP01337 |
DFDGAMPGVLRFG
|
13 | Caenorhabditis elegans | FMRFamide related peptide | FLP-18 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
| NP01338 |
EMPGVLRFG
|
9 | Caenorhabditis elegans | FMRFamide related peptide | FLP-18 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
| NP01339 |
SVPGVLRFG
|
9 | Caenorhabditis elegans | FMRFamide related peptide | FLP-18 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
| NP01340 |
ASWASSVRF
|
9 | Caenorhabditis elegans | FMRFamide related peptide | FLP-19 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP01341 |
WANQVRFG
|
8 | Caenorhabditis elegans | FMRFamide related peptide | FLP-19 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
| NP01342 |
LRGEPIRFG
|
9 | Caenorhabditis elegans | FMRFamide related peptide | FLP-2 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
| NP01343 |
AMMRFG
|
6 | Caenorhabditis elegans | FMRFamide related peptide | FLP-20 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
| NP01344 |
GLGPRPLRF
|
9 | Caenorhabditis elegans | FMRFamide related peptide | FLP-21 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP01345 |
SPREPIRF
|
8 | Caenorhabditis elegans | FMRFamide related peptide | FLP-2-1 | 20806053#Jarecki JL, Andersen K, Konop CJ, Knickelbine JJ, Vestling MM, Stretton AO#Mapping neuropeptide expression by mass spectrometry in single dissected identified neurons from the dorsal ganglion of the nematode Ascaris suum#ACS Chem Neurosci 2010 Jul 21;1(7):505-519 | |
| NP01346 |
SPSAKWMRF
|
9 | Caenorhabditis elegans | FMRFamide related peptide | FLP-22 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP01347 |
SPSAKWMRFG
|
10 | Caenorhabditis elegans | FMRFamide related peptide | FLP-22 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
| NP01348 |
VPSAGDMMVRFG
|
12 | Caenorhabditis elegans | FMRFamide related peptide | FLP-24 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
| NP01349 |
ASYDYIRF
|
8 | Caenorhabditis elegans | FMRFamide related peptide | FLP-25 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP01350 |
DYDFVRF
|
7 | Caenorhabditis elegans | FMRFamide related peptide | FLP-25 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP01351 |
DYDFVRFG
|
8 | Caenorhabditis elegans | FMRFamide related peptide | FLP-25 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
| NP01352 |
EFNADDLTLRFG
|
12 | Caenorhabditis elegans | FMRFamide related peptide | FLP-26 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
| NP01353 |
FRLPFQFFGANEDFNSGLT
|
19 | Caenorhabditis elegans | FMRFamide related peptide | FLP-26 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
| NP01354 |
GGAGEPLAFSPDMLSLRFG
|
19 | Caenorhabditis elegans | FMRFamide related peptide | FLP-26 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
| NP01355 |
APNRVLMRF
|
9 | Caenorhabditis elegans | FMRFamide related peptide | FLP-28 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP01356 |
APNRVLMRFG
|
10 | Caenorhabditis elegans | FMRFamide related peptide | FLP-28 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
| NP01357 |
VLMRFG
|
6 | Caenorhabditis elegans | FMRFamide related peptide | FLP-28 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
| NP01358 |
ASEDALFGTMRFG
|
13 | Caenorhabditis elegans | FMRFamide related peptide | FLP-3 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
| NP01359 |
NPLGTMRFG
|
9 | Caenorhabditis elegans | FMRFamide related peptide | FLP-3 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
| NP01360 |
AMRNSLVRF
|
9 | Caenorhabditis elegans | FMRFamide related peptide | FLP-32 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP01361 |
APLEGFEDMSGFLRTIDGIQKPRF
|
24 | Caenorhabditis elegans | FMRFamide related peptide | FLP-33 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP01362 |
ASPSFIRF
|
8 | Caenorhabditis elegans | FMRFamide related peptide | FLP-4 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP01363 |
AGAKFIRFG
|
9 | Caenorhabditis elegans | FMRFamide related peptide | FLP-5 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
| NP01364 |
APKPKFIRFG
|
10 | Caenorhabditis elegans | FMRFamide related peptide | FLP-5 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
| NP01365 |
KSAYMRFG
|
8 | Caenorhabditis elegans | FMRFamide related peptide | FLP-6 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
| NP01366 |
SPMQRSSMVRFG
|
12 | Caenorhabditis elegans | FMRFamide related peptide | FLP-7 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
| NP01367 |
TPMQRSSMVRFG
|
12 | Caenorhabditis elegans | FMRFamide related peptide | FLP-7 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
| NP01368 |
SPMQRSSMVRF
|
11 | Caenorhabditis elegans | FMRFamide related peptide | FLP-7-1 | 20806053#Jarecki JL, Andersen K, Konop CJ, Knickelbine JJ, Vestling MM, Stretton AO#Mapping neuropeptide expression by mass spectrometry in single dissected identified neurons from the dorsal ganglion of the nematode Ascaris suum#ACS Chem Neurosci 2010 Jul 21;1(7):505-519 | |
| NP01369 |
TPMQRSSMVRF
|
11 | Caenorhabditis elegans | FMRFamide related peptide | FLP-7-2 | 20806053#Jarecki JL, Andersen K, Konop CJ, Knickelbine JJ, Vestling MM, Stretton AO#Mapping neuropeptide expression by mass spectrometry in single dissected identified neurons from the dorsal ganglion of the nematode Ascaris suum#ACS Chem Neurosci 2010 Jul 21;1(7):505-519 | |
| NP01370 |
SPMERSAMVRF
|
11 | Caenorhabditis elegans | FMRFamide related peptide | FLP-7-3 | 20806053#Jarecki JL, Andersen K, Konop CJ, Knickelbine JJ, Vestling MM, Stretton AO#Mapping neuropeptide expression by mass spectrometry in single dissected identified neurons from the dorsal ganglion of the nematode Ascaris suum#ACS Chem Neurosci 2010 Jul 21;1(7):505-519 | |
| NP01371 |
SPMDRSKMVRF
|
11 | Caenorhabditis elegans | FMRFamide related peptide | FLP-7-4 | 20806053#Jarecki JL, Andersen K, Konop CJ, Knickelbine JJ, Vestling MM, Stretton AO#Mapping neuropeptide expression by mass spectrometry in single dissected identified neurons from the dorsal ganglion of the nematode Ascaris suum#ACS Chem Neurosci 2010 Jul 21;1(7):505-519 | |
| NP01372 |
KNEFIRF
|
7 | Caenorhabditis elegans | FMRFamide related peptide | FLP-8 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP01373 |
LRGEPIRF
|
8 | Caenorhabditis elegans | FMRFamide related peptide | FMRFamide-like peptide | 20806053#Jarecki JL, Andersen K, Konop CJ, Knickelbine JJ, Vestling MM, Stretton AO#Mapping neuropeptide expression by mass spectrometry in single dissected identified neurons from the dorsal ganglion of the nematode Ascaris suum#ACS Chem Neurosci 2010 Jul 21;1(7):505-519 | |
| NP01374 |
GAMPGVLRF
|
9 | Caenorhabditis elegans | FMRFamide related peptide | FMRFamide-related peptide | 16061202#Husson SJ, Clynen E, Baggerman G, De Loof A, Schoofs L#Discovering neuropeptides in Caenorhabditis elegans by two dimensional liquid chromatography and mass spectrometry#Biochem Biophys Res Commun 2005 Sep 16;335(1):76-86 | |
| NP01375 |
SYFDEKKSVPGVLRF
|
15 | Caenorhabditis elegans | FMRFamide related peptide | FMRFamide-related peptide | 16061202#Husson SJ, Clynen E, Baggerman G, De Loof A, Schoofs L#Discovering neuropeptides in Caenorhabditis elegans by two dimensional liquid chromatography and mass spectrometry#Biochem Biophys Res Commun 2005 Sep 16;335(1):76-86 | |
| NP01376 |
AVPGVLRF
|
8 | Caenorhabditis elegans | FMRFamide related peptide | Neuropeptide AF3 | 12865086#Moffett CL, Beckett AM, Mousley A, Geary TG, Marks NJ, Halton DW, Thompson DP, Maule AG#The ovijector of Ascaris suum: multiple response types revealed by Caenorhabditis elegans FMRFamide-related peptides#Int J Parasitol 2003 Jul 30;33(8):859-76 | |
| NP01377 |
GDVPGVLRF
|
9 | Caenorhabditis elegans | FMRFamide related peptide | Neuropeptide AF4 | 12865086#Moffett CL, Beckett AM, Mousley A, Geary TG, Marks NJ, Halton DW, Thompson DP, Maule AG#The ovijector of Ascaris suum: multiple response types revealed by Caenorhabditis elegans FMRFamide-related peptides#Int J Parasitol 2003 Jul 30;33(8):859-76 | |
| NP01378 |
KPNFIRF
|
7 | Caenorhabditis elegans | FMRFamide related peptide | Neuropeptide PF4 | 12865086#Moffett CL, Beckett AM, Mousley A, Geary TG, Marks NJ, Halton DW, Thompson DP, Maule AG#The ovijector of Ascaris suum: multiple response types revealed by Caenorhabditis elegans FMRFamide-related peptides#Int J Parasitol 2003 Jul 30;33(8):859-76 | |
| NP01379 |
FNADDLTLRF
|
10 | Caenorhabditis elegans | FMRFamide related peptide | Novel FaRP | 16061202#Husson SJ, Clynen E, Baggerman G, De Loof A, Schoofs L#Discovering neuropeptides in Caenorhabditis elegans by two dimensional liquid chromatography and mass spectrometry#Biochem Biophys Res Commun 2005 Sep 16;335(1):76-86 | |
| NP01621 |
AAADPNFLRF
|
10 | Caenorhabditis elegans | FMRFamide related peptide | AAADPNFLRF-amide | 8483810# Rosoff M.L., Doble K.E., Price D.A., Li C.; #The flp-1 propeptide is processed into multiple, highly similar FMRFamide-like peptides in Caenorhabditis elegans.; # Peptides 14:331-338(1993).$16061202#Husson S.J., Clynen E., Baggerman G., De Loof A., Schoofs L.; #Discovering neuropeptides in Caenorhabditis elegans by two dimensional liquid chromatography and mass spectrometry.; #Biochem. Biophys. Res. Commun. 335:76-86(2005). | |
| NP01622 |
AGSDPNFLRF
|
10 | Caenorhabditis elegans | FMRFamide related peptide | AGSDPNFLRF-amide | 8483810#Rosoff M.L., Doble K.E., Price D.A., Li C.; #The flp-1 propeptide is processed into multiple, highly similar FMRFamide-like peptides in Caenorhabditis elegans.; #Peptides 14:331-338(1993). | |
| NP01623 |
ASGDPNFLRF
|
10 | Caenorhabditis elegans | FMRFamide related peptide | ASGDPNFLRF-amide | 8483810#Rosoff M.L., Doble K.E., Price D.A., Li C.; #The flp-1 propeptide is processed into multiple, highly similar FMRFamide-like peptides in Caenorhabditis elegans.; #Peptides 14:331-338(1993). | |
| NP01624 |
SDPNFLRF
|
8 | Caenorhabditis elegans | FMRFamide related peptide | Neuropeptide PF1 | 8483810#Rosoff M.L., Doble K.E., Price D.A., Li C.; #The flp-1 propeptide is processed into multiple, highly similar FMRFamide-like peptides in Caenorhabditis elegans.; #Peptides 14:331-338(1993). | |
| NP01625 |
PNFLRF
|
6 | Caenorhabditis elegans | FMRFamide related peptide | PNFLRF-amide | 8483810#Rosoff M.L., Doble K.E., Price D.A., Li C.; #The flp-1 propeptide is processed into multiple, highly similar FMRFamide-like peptides in Caenorhabditis elegans.; #Peptides 14:331-338(1993). | |
| NP01626 |
PNFMRY
|
6 | Caenorhabditis elegans | FMRFamide related peptide | PNFMRY-amide | 8483810#Rosoff M.L., Doble K.E., Price D.A., Li C.; #The flp-1 propeptide is processed into multiple, highly similar FMRFamide-like peptides in Caenorhabditis elegans.; #Peptides 14:331-338(1993). | |
| NP01627 |
SADPNFLRF
|
9 | Caenorhabditis elegans | FMRFamide related peptide | SADPNFLRF-amide | 8483810# Rosoff M.L., Doble K.E., Price D.A., Li C.; #The flp-1 propeptide is processed into multiple, highly similar FMRFamide-like peptides in Caenorhabditis elegans.; # Peptides 14:331-338(1993).$16061202#Husson S.J., Clynen E., Baggerman G., De Loof A., Schoofs L.; #Discovering neuropeptides in Caenorhabditis elegans by two dimensional liquid chromatography and mass spectrometry.; #Biochem. Biophys. Res. Commun. 335:76-86(2005). | |
| NP01628 |
SQPNFLRF
|
8 | Caenorhabditis elegans | FMRFamide related peptide | SQPNFLRF-amide | 8483810#Rosoff M.L., Doble K.E., Price D.A., Li C.; #The flp-1 propeptide is processed into multiple, highly similar FMRFamide-like peptides in Caenorhabditis elegans.; #Peptides 14:331-338(1993). | |
| NP01629 |
ASEDALFGTMRF
|
12 | Caenorhabditis elegans | FMRFamide related peptide | ASEDALFGTMRF-amide | 16061202#Husson S.J., Clynen E., Baggerman G., De Loof A., Schoofs L.; #Discovering neuropeptides in Caenorhabditis elegans by two dimensional liquid chromatography and mass spectrometry.; #Biochem. Biophys. Res. Commun. 335:76-86(2005). | |
| NP01630 |
EAEEPLGTMRF
|
11 | Caenorhabditis elegans | FMRFamide related peptide | EAEEPLGTMRF-amide | 16061202#Husson S.J., Clynen E., Baggerman G., De Loof A., Schoofs L.; #Discovering neuropeptides in Caenorhabditis elegans by two dimensional liquid chromatography and mass spectrometry.; #Biochem. Biophys. Res. Commun. 335:76-86(2005). | |
| NP01631 |
NPENDTPFGTMRF
|
13 | Caenorhabditis elegans | FMRFamide related peptide | NPENDTPFGTMRF-amide | 16061202#Husson S.J., Clynen E., Baggerman G., De Loof A., Schoofs L.; #Discovering neuropeptides in Caenorhabditis elegans by two dimensional liquid chromatography and mass spectrometry.; #Biochem. Biophys. Res. Commun. 335:76-86(2005). | |
| NP01632 |
NPLGTMRF
|
8 | Caenorhabditis elegans | FMRFamide related peptide | NPLGTMRF-amide (Potential) | ||
| NP01633 |
SADDSAPFGTMRF
|
13 | Caenorhabditis elegans | FMRFamide related peptide | SADDSAPFGTMRF-amide | 16061202#Husson S.J., Clynen E., Baggerman G., De Loof A., Schoofs L.; #Discovering neuropeptides in Caenorhabditis elegans by two dimensional liquid chromatography and mass spectrometry.; #Biochem. Biophys. Res. Commun. 335:76-86(2005). | |
| NP01634 |
SAEPFGTMRF
|
10 | Caenorhabditis elegans | FMRFamide related peptide | SAEPFGTMRF-amide | 16061202#Husson S.J., Clynen E., Baggerman G., De Loof A., Schoofs L.; #Discovering neuropeptides in Caenorhabditis elegans by two dimensional liquid chromatography and mass spectrometry.; #Biochem. Biophys. Res. Commun. 335:76-86(2005). | |
| NP01635 |
SPLGTMRF
|
8 | Caenorhabditis elegans | FMRFamide related peptide | SPLGTMRF-amide (Potential) | ||
| NP01636 |
TPLGTMRF
|
8 | Caenorhabditis elegans | FMRFamide related peptide | TPLGTMRF-amide | 16061202#Husson S.J., Clynen E., Baggerman G., De Loof A., Schoofs L.; #Discovering neuropeptides in Caenorhabditis elegans by two dimensional liquid chromatography and mass spectrometry.; #Biochem. Biophys. Res. Commun. 335:76-86(2005). | |
| NP01637 |
AGAKFIRF
|
8 | Caenorhabditis elegans | FMRFamide related peptide | AGAKFIRF-amide | ||
| NP01638 |
APKPKFIRF
|
9 | Caenorhabditis elegans | FMRFamide related peptide | APKPKFIRF-amide (Potential) | ||
| NP01639 |
GAKFIRF
|
7 | Caenorhabditis elegans | FMRFamide related peptide | GAKFIRF-amide | 16061202#Husson S.J., Clynen E., Baggerman G., De Loof A., Schoofs L.; #Discovering neuropeptides in Caenorhabditis elegans by two dimensional liquid chromatography and mass spectrometry.; #Biochem. Biophys. Res. Commun. 335:76-86(2005). | |
| NP01640 |
KSAYMRF
|
7 | Caenorhabditis elegans | FMRFamide related peptide | KSAYMRF-amide 1 | 9675153#Marks N.J., Maule A.G., Geary T.G., Thompson D.P., Li C., Halton D.W., Shaw C.; #KSAYMRFamide (PF3/AF8) is present in the free-living nematode, Caenorhabditis elegans.; #Biochem. Biophys. Res. Commun. 248:422-425(1998). | |
| NP01641 |
QQDSEVEREMM
|
11 | Caenorhabditis elegans | FMRFamide related peptide | QQDSEVEREMM | 16061202#Husson S.J., Clynen E., Baggerman G., De Loof A., Schoofs L.; #Discovering neuropeptides in Caenorhabditis elegans by two dimensional liquid chromatography and mass spectrometry.; #Biochem. Biophys. Res. Commun. 335:76-86(2005). | |
| NP01642 |
KPSFVRF
|
7 | Caenorhabditis elegans | FMRFamide related peptide | KPSFVRF-amide 1 | 9920762# Marks N.J., Maule A.G., Li C., Nelson L.S., Thompson D.P., Alexander-Bowman S., Geary T.G., Halton D.W., Verhaert P., Shaw C.; #Isolation, pharmacology and gene organization of KPSFVRFamide: a neuropeptide from Caenorhabditis elegans.; # Biochem. Biophys. Res. Commun. 254:222-230(1999).$16061202#Husson S.J., Clynen E., Baggerman G., De Loof A., Schoofs L.; #Discovering neuropeptides in Caenorhabditis elegans by two dimensional liquid chromatography and mass spectrometry.; #Biochem. Biophys. Res. Commun. 335:76-86(2005). | |
| NP01643 |
AMRNALVRF
|
9 | Caenorhabditis elegans | FMRFamide related peptide | AMRNALVRF-amide (Potential) | ||
| NP01644 |
ASGGMRNALVRF
|
12 | Caenorhabditis elegans | FMRFamide related peptide | ASGGMRNALVRF-amide | 16061202#Husson S.J., Clynen E., Baggerman G., De Loof A., Schoofs L.; #Discovering neuropeptides in Caenorhabditis elegans by two dimensional liquid chromatography and mass spectrometry.; #Biochem. Biophys. Res. Commun. 335:76-86(2005). | |
| NP01645 |
NGAPQPFVRF
|
10 | Caenorhabditis elegans | FMRFamide related peptide | Neuropeptide AF22 | 16061202#Husson S.J., Clynen E., Baggerman G., De Loof A., Schoofs L.; #Discovering neuropeptides in Caenorhabditis elegans by two dimensional liquid chromatography and mass spectrometry.; #Biochem. Biophys. Res. Commun. 335:76-86(2005). | |
| NP01646 |
SPLDEEDFAPESPLQ
|
15 | Caenorhabditis elegans | FMRFamide related peptide | SPLDEEDFAPESPLQ-amide | 16061202#Husson S.J., Clynen E., Baggerman G., De Loof A., Schoofs L.; #Discovering neuropeptides in Caenorhabditis elegans by two dimensional liquid chromatography and mass spectrometry.; #Biochem. Biophys. Res. Commun. 335:76-86(2005). | |
| NP01647 |
AADGAPLIRF
|
10 | Caenorhabditis elegans | FMRFamide related peptide | AADGAPLIRF-amide 1 | 16061202# Husson S.J., Clynen E., Baggerman G., De Loof A., Schoofs L.; #Discovering neuropeptides in Caenorhabditis elegans by two dimensional liquid chromatography and mass spectrometry.; # Biochem. Biophys. Res. Commun. 335:76-86(2005).$11527423#Marks N.J., Shaw C., Halton D.W., Thompson D.P., Geary T.G., Li C., Maule A.G.; #Isolation and preliminary biological assessment of AADGAPLIRFamide and SVPGVLRFamide from Caenorhabditis elegans.; #Biochem. Biophys. Res. Commun. 286:1170-1176(2001). | |
| NP01648 |
AMDSPLIRF
|
9 | Caenorhabditis elegans | FMRFamide related peptide | AMDSPLIRF-amide | 16061202#Husson S.J., Clynen E., Baggerman G., De Loof A., Schoofs L.; #Discovering neuropeptides in Caenorhabditis elegans by two dimensional liquid chromatography and mass spectrometry.; #Biochem. Biophys. Res. Commun. 335:76-86(2005). | |
| NP01649 |
APEASPFIRF
|
10 | Caenorhabditis elegans | FMRFamide related peptide | APEASPFIRF-amide 2 | 16061202# Husson S.J., Clynen E., Baggerman G., De Loof A., Schoofs L.; #Discovering neuropeptides in Caenorhabditis elegans by two dimensional liquid chromatography and mass spectrometry.; # Biochem. Biophys. Res. Commun. 335:76-86(2005).$9070852#Marks N.J., Maule A.G., Geary T.G., Thompson D.P., Davis J.P., Halton D.W., Verhaert P., Shaw C.; #APEASPFIRFamide, a novel FMRFamide-related decapeptide from Caenorhabditis elegans: structure and myoactivity.; #Biochem. Biophys. Res. Commun. 231:591-595(1997). | |
| NP01650 |
ASPSAPLIRF
|
10 | Caenorhabditis elegans | FMRFamide related peptide | ASPSAPLIRF-amide | 16061202#Husson S.J., Clynen E., Baggerman G., De Loof A., Schoofs L.; #Discovering neuropeptides in Caenorhabditis elegans by two dimensional liquid chromatography and mass spectrometry.; #Biochem. Biophys. Res. Commun. 335:76-86(2005). | |
| NP01651 |
ASSAPLIRF
|
9 | Caenorhabditis elegans | FMRFamide related peptide | ASSAPLIRF-amide (Potential) | ||
| NP01652 |
SAAAPLIRF
|
9 | Caenorhabditis elegans | FMRFamide related peptide | SAAAPLIRF-amide | 16061202#Husson S.J., Clynen E., Baggerman G., De Loof A., Schoofs L.; #Discovering neuropeptides in Caenorhabditis elegans by two dimensional liquid chromatography and mass spectrometry.; #Biochem. Biophys. Res. Commun. 335:76-86(2005). | |
| NP01653 |
SDRPTRAMDSPLIRF
|
15 | Caenorhabditis elegans | FMRFamide related peptide | SDRPTRAMDSPLIRF-amide (Potential) | ||
| NP01654 |
SPSAVPLIRF
|
10 | Caenorhabditis elegans | FMRFamide related peptide | SPSAVPLIRF-amide | 16061202#Husson S.J., Clynen E., Baggerman G., De Loof A., Schoofs L.; #Discovering neuropeptides in Caenorhabditis elegans by two dimensional liquid chromatography and mass spectrometry.; #Biochem. Biophys. Res. Commun. 335:76-86(2005). | |
| NP01655 |
KHEYLRF
|
7 | Caenorhabditis elegans | FMRFamide related peptide | Neuropeptide AF2 | 8554607#Marks N.J., Shaw C., Maule A.G., Davis J.P., Halton D.W., Verhaert P., Geary T.G., Thompson D.P.; #Isolation of AF2 (KHEYLRFamide) from Caenorhabditis elegans: evidence for the presence of more than one FMRFamide-related peptide-encoding gene.; #Biochem. Biophys. Res. Commun. 217:845-851(1995). | |
| NP01656 |
AQTFVRF
|
7 | Caenorhabditis elegans | FMRFamide related peptide | AQTFVRF-amide 1 | 16061202#Husson S.J., Clynen E., Baggerman G., De Loof A., Schoofs L.; #Discovering neuropeptides in Caenorhabditis elegans by two dimensional liquid chromatography and mass spectrometry.; #Biochem. Biophys. Res. Commun. 335:76-86(2005). | |
| NP01657 |
GQTFVRF
|
7 | Caenorhabditis elegans | FMRFamide related peptide | GQTFVRF-amide | 16061202#Husson S.J., Clynen E., Baggerman G., De Loof A., Schoofs L.; #Discovering neuropeptides in Caenorhabditis elegans by two dimensional liquid chromatography and mass spectrometry.; #Biochem. Biophys. Res. Commun. 335:76-86(2005). | |
| NP01658 |
DVPGVLRF
|
8 | Caenorhabditis elegans | FMRFamide related peptide | DVPGVLRF-amide | ||
| NP01659 |
EIPGVLRF
|
8 | Caenorhabditis elegans | FMRFamide related peptide | EIPGVLRF-amide | ||
| NP01660 |
EMPGVLRF
|
8 | Caenorhabditis elegans | FMRFamide related peptide | EMPGVLRF-amide | 16187307#Papaioannou S., Marsden D., Franks C.J., Walker R.J., Holden-Dye L.; #Role of a FMRFamide-like family of neuropeptides in the pharyngeal nervous system of Caenorhabditis elegans.; #J. Neurobiol. 65:304-319(2005). | |
| NP01661 |
SEVPGVLRF
|
9 | Caenorhabditis elegans | FMRFamide related peptide | SEVPGVLRF-amide | ||
| NP01662 |
SVPGVLRF
|
8 | Caenorhabditis elegans | FMRFamide related peptide | SVPGVLRF-amide 1 | 11527423#Marks N.J., Shaw C., Halton D.W., Thompson D.P., Geary T.G., Li C., Maule A.G.; #Isolation and preliminary biological assessment of AADGAPLIRFamide and SVPGVLRFamide from Caenorhabditis elegans.; #Biochem. Biophys. Res. Commun. 286:1170-1176(2001). | |
| NP01663 |
WANQVRF
|
7 | Caenorhabditis elegans | FMRFamide related peptide | WANQVRF-amide | 16061202#Husson S.J., Clynen E., Baggerman G., De Loof A., Schoofs L.; #Discovering neuropeptides in Caenorhabditis elegans by two dimensional liquid chromatography and mass spectrometry.; #Biochem. Biophys. Res. Commun. 335:76-86(2005). | |
| NP01664 |
VVGQQDFLRF
|
10 | Caenorhabditis elegans | FMRFamide related peptide | VVGQQDFLRF-amide (Potential) | ||
| NP01665 |
VPSAGDMMVRF
|
11 | Caenorhabditis elegans | FMRFamide related peptide | Neuropeptide AF 36 | 16061202#Husson S.J., Clynen E., Baggerman G., De Loof A., Schoofs L.; #Discovering neuropeptides in Caenorhabditis elegans by two dimensional liquid chromatography and mass spectrometry.; #Biochem. Biophys. Res. Commun. 335:76-86(2005). | |
| NP01666 |
EFNADDLTLRF
|
11 | Caenorhabditis elegans | FMRFamide related peptide | EFNADDLTLRF-amide | 16061202#Husson S.J., Clynen E., Baggerman G., De Loof A., Schoofs L.; #Discovering neuropeptides in Caenorhabditis elegans by two dimensional liquid chromatography and mass spectrometry.; #Biochem. Biophys. Res. Commun. 335:76-86(2005). | |
| NP01667 |
GGAGEPLAFSPDMLSLRF
|
18 | Caenorhabditis elegans | FMRFamide related peptide | GGAGEPLAFSPDMLSLRF-amide | 16061202#Husson S.J., Clynen E., Baggerman G., De Loof A., Schoofs L.; #Discovering neuropeptides in Caenorhabditis elegans by two dimensional liquid chromatography and mass spectrometry.; #Biochem. Biophys. Res. Commun. 335:76-86(2005). | |
| NP01668 |
EASAFGDIIGELKGKGLGGRMRF
|
23 | Caenorhabditis elegans | FMRFamide related peptide | EASAFGDIIGELKGKGLGGRMRF-amide | 19456328#Clynen E., Husson S.J., Schoofs L.; #Identification of new members of the (short) neuropeptide F family in locusts and Caenorhabditis elegans.; #Ann. N. Y. Acad. Sci. 1163:60-74(2009). | |
| NP03235 |
APKQMVFGF
|
9 | Caenorhabditis elegans | NA | Neuropeptide- like protein (NLP) peptide | 16061202#Husson SJ, Clynen E, Baggerman G, De Loof A, Schoofs L#Discovering neuropeptides in Caenorhabditis elegans by two dimensional liquid chromatography and mass spectrometry#Biochem Biophys Res Commun 2005 Sep 16;335(1):76-86 | |
| NP03236 |
APGLFELPSRSV
|
12 | Caenorhabditis elegans | NA | NLP peptide | 16061202#Husson SJ, Clynen E, Baggerman G, De Loof A, Schoofs L#Discovering neuropeptides in Caenorhabditis elegans by two dimensional liquid chromatography and mass spectrometry#Biochem Biophys Res Commun 2005 Sep 16;335(1):76-86 | |
| NP03237 |
YPYLIFPASPSSGDSRRLV
|
19 | Caenorhabditis elegans | NA | NLP peptide | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP03238 |
MDANAFRMSF
|
10 | Caenorhabditis elegans | NA | NLP-1 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP03239 |
MDANAFRMSFG
|
11 | Caenorhabditis elegans | NA | NLP-1 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
| NP03240 |
MDPNAFRMSF
|
10 | Caenorhabditis elegans | NA | NLP-1 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP03241 |
VNLDPNSFRMSF
|
12 | Caenorhabditis elegans | NA | NLP-1 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP03242 |
AIPFNGGMYG
|
10 | Caenorhabditis elegans | NA | NLP-10 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
| NP03243 |
GAMPFSGGMYG
|
11 | Caenorhabditis elegans | NA | NLP-10 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
| NP03244 |
SGQIFAQ
|
7 | Caenorhabditis elegans | NA | NLP-10 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
| NP03245 |
SLVPQSYSNNENQI
|
14 | Caenorhabditis elegans | NA | NLP-10 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
| NP03246 |
STMPFSGGMYG
|
11 | Caenorhabditis elegans | NA | NLP-10 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
| NP03247 |
HISPSYDVEIDAGNMRNLLDI
|
21 | Caenorhabditis elegans | NA | NLP-11 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP03248 |
HISPSYDVEIDAGNMRNLLDIG
|
22 | Caenorhabditis elegans | NA | NLP-11 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
| NP03249 |
SAPMASDYGNQFQMYNRLIDA
|
21 | Caenorhabditis elegans | NA | NLP-11 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP03250 |
SAPMASDYGNQFQMYNRLIDAG
|
22 | Caenorhabditis elegans | NA | NLP-11 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
| NP03251 |
SPAISPAYQFENAFGLSEALERAG
|
24 | Caenorhabditis elegans | NA | NLP-11 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
| NP03252 |
DGYRPLQF
|
8 | Caenorhabditis elegans | NA | NLP-12 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP03253 |
DYRPLQF
|
7 | Caenorhabditis elegans | NA | NLP-12 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP03254 |
AEDYERQIMAF
|
11 | Caenorhabditis elegans | NA | NLP-13 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP03255 |
NDFSRDIMSF
|
10 | Caenorhabditis elegans | NA | NLP-13 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP03256 |
SAPSDFSRDIMSF
|
13 | Caenorhabditis elegans | NA | NLP-13 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP03257 |
SAPSDFSRDIMSFG
|
14 | Caenorhabditis elegans | NA | NLP-13 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
| NP03258 |
SGNTADLYDRRIMAF
|
15 | Caenorhabditis elegans | NA | NLP-13 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP03259 |
SPVDYDRPIMAF
|
12 | Caenorhabditis elegans | NA | NLP-13 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP03260 |
SPVDYDRPIMAFG
|
13 | Caenorhabditis elegans | NA | NLP-13 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
| NP03261 |
SSSMYDRDIMSF
|
12 | Caenorhabditis elegans | NA | NLP-13 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP03262 |
SSSMYDRDIMSFG
|
13 | Caenorhabditis elegans | NA | NLP-13 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
| NP03263 |
ALDGLDGAGFGFD
|
13 | Caenorhabditis elegans | NA | NLP-14 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP03264 |
ALDGLDGSGFGFD
|
13 | Caenorhabditis elegans | NA | NLP-14 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP03265 |
ALNSLDGAGFGFE
|
13 | Caenorhabditis elegans | NA | NLP-14 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP03266 |
ALNSLDGNGFGFD
|
13 | Caenorhabditis elegans | NA | NLP-14 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP03267 |
ALNSLDGQGFGFE
|
13 | Caenorhabditis elegans | NA | NLP-14 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP03268 |
AAVRLRPVGSLFFLNRPHE
|
19 | Caenorhabditis elegans | NA | NLP-15 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
| NP03269 |
AFDSLAGQGFTGFE
|
14 | Caenorhabditis elegans | NA | NLP-15 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP03270 |
AFDSLAGSGFDNGFN
|
15 | Caenorhabditis elegans | NA | NLP-15 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP03271 |
AFDSLAGSGFGAFN
|
14 | Caenorhabditis elegans | NA | NLP-15 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP03272 |
AFDSLAGSGFSGFD
|
14 | Caenorhabditis elegans | NA | NLP-15 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP03273 |
NAEDHHEHQ
|
9 | Caenorhabditis elegans | NA | NLP-16 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP03274 |
SVDEHHGHQ
|
9 | Caenorhabditis elegans | NA | NLP-16 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP03275 |
GSLSNMMRI
|
9 | Caenorhabditis elegans | NA | NLP-17 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP03276 |
ASPYGFAFA
|
9 | Caenorhabditis elegans | NA | NLP-18 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP03277 |
SDEENLDFLE
|
10 | Caenorhabditis elegans | NA | NLP-18 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP03278 |
SPYRAFAFA
|
9 | Caenorhabditis elegans | NA | NLP-18 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP03279 |
SPYRTFAFA
|
9 | Caenorhabditis elegans | NA | NLP-18 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP03280 |
IGLRLPNML
|
9 | Caenorhabditis elegans | NA | NLP-19 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP03281 |
FAFA
|
4 | Caenorhabditis elegans | NA | NLP-20 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
| NP03282 |
SGPQAHEGAGMRFAFA
|
16 | Caenorhabditis elegans | NA | NLP-20 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP03283 |
GGARAFLTEM
|
10 | Caenorhabditis elegans | NA | NLP-21 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP03284 |
GGARAFVENS
|
10 | Caenorhabditis elegans | NA | NLP-21 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP03285 |
GGARAFYDE
|
9 | Caenorhabditis elegans | NA | NLP-21 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP03286 |
GGARVFQGFEDE
|
12 | Caenorhabditis elegans | NA | NLP-21 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP03287 |
QYTSELEEDE
|
10 | Caenorhabditis elegans | NA | NLP-21 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP03288 |
GGFGQQSQFG
|
10 | Caenorhabditis elegans | NA | NLP-26 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP03289 |
AINPFLDSMG
|
10 | Caenorhabditis elegans | NA | NLP-3 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
| NP03290 |
AVNPFLDSIG
|
10 | Caenorhabditis elegans | NA | NLP-3 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
| NP03291 |
ARMMSFDAEAPQYLQHLLQNLKPRF
|
25 | Caenorhabditis elegans | NA | NLP-35 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
| NP03292 |
AVVSGYDNIYQVLAPRF
|
17 | Caenorhabditis elegans | NA | NLP-35 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP03293 |
NNAEVVNHILKNFGALDRLGDV
|
22 | Caenorhabditis elegans | NA | NLP-37 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP03294 |
NNAEVVNHILKNFGALDRLGDVG
|
23 | Caenorhabditis elegans | NA | NLP-37 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
| NP03295 |
ASDDRVLGWNKAHGLW
|
16 | Caenorhabditis elegans | NA | NLP-38 | 18760316#Husson SJ, Landuyt B, Nys T, Baggerman G, Boonen K, Clynen E, Lindemans M, Janssen T, Schoofs L#Comparative peptidomics of Caenorhabditis elegans versus C#briggsae by LC-MALDI-TOF MS Peptides 2009 Mar;30(3):449-57 | |
| NP03296 |
SPAQWQRANGLW
|
12 | Caenorhabditis elegans | NA | NLP-38 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP03297 |
SPAQWQRANGLWG
|
13 | Caenorhabditis elegans | NA | NLP-38 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
| NP03298 |
TPQNWNKLNSLW
|
12 | Caenorhabditis elegans | NA | NLP-38 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP03299 |
TPQNWNKLNSLWG
|
13 | Caenorhabditis elegans | NA | NLP-38 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
| NP03300 |
VLGWNKAHGLWG
|
12 | Caenorhabditis elegans | NA | NLP-38 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
| NP03301 |
EVPNFQADNVPEAGGRV
|
17 | Caenorhabditis elegans | NA | NLP-39 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP03302 |
APSAPAGLEEKL
|
12 | Caenorhabditis elegans | NA | NLP-40 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
| NP03303 |
APSAPAGLEEKLR
|
13 | Caenorhabditis elegans | NA | NLP-40 | 18760316#Husson SJ, Landuyt B, Nys T, Baggerman G, Boonen K, Clynen E, Lindemans M, Janssen T, Schoofs L#Comparative peptidomics of Caenorhabditis elegans versus C#briggsae by LC-MALDI-TOF MS Peptides 2009 Mar;30(3):449-57 | |
| NP03304 |
APGLFELPSRSVRLI
|
15 | Caenorhabditis elegans | NA | NLP-41 | 18760316#Husson SJ, Landuyt B, Nys T, Baggerman G, Boonen K, Clynen E, Lindemans M, Janssen T, Schoofs L#Comparative peptidomics of Caenorhabditis elegans versus C#briggsae by LC-MALDI-TOF MS Peptides 2009 Mar;30(3):449-57 | |
| NP03305 |
ALQHFSSLDTLGGMGFG
|
17 | Caenorhabditis elegans | NA | NLP-5 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
| NP03306 |
SVSQLNQYAGFDTLGGMGL
|
19 | Caenorhabditis elegans | NA | NLP-5 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP03307 |
SVSQLNQYAGFDTLGGMGLG
|
20 | Caenorhabditis elegans | NA | NLP-5 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
| NP03308 |
AAMRSFNMGF
|
10 | Caenorhabditis elegans | NA | NLP-6 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP03309 |
AAMRSFNMGFG
|
11 | Caenorhabditis elegans | NA | NLP-6 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
| NP03310 |
APKQMVFGFG
|
10 | Caenorhabditis elegans | NA | NLP-6 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
| NP03311 |
SAEPQIDYEDMSADLEEIPVFIQ
|
23 | Caenorhabditis elegans | NA | NLP-6 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
| NP03312 |
SMADISDMPEDVPM
|
14 | Caenorhabditis elegans | NA | NLP-6 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
| NP03313 |
YKPRSFAMGF
|
10 | Caenorhabditis elegans | NA | NLP-6 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP03314 |
YKPRSFAMGFG
|
11 | Caenorhabditis elegans | NA | NLP-6 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
| NP03315 |
LYLKQADFDDPRMFTSSF
|
18 | Caenorhabditis elegans | NA | NLP-7 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP03316 |
LYLKQADFDDPRMFTSSFG
|
19 | Caenorhabditis elegans | NA | NLP-7 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
| NP03317 |
MILPSLADLHRYTMYD
|
16 | Caenorhabditis elegans | NA | NLP-7 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP03318 |
QADFDDPRMFTSSF
|
14 | Caenorhabditis elegans | NA | NLP-7 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP03319 |
SMDDLDDPRLMTMSF
|
15 | Caenorhabditis elegans | NA | NLP-7 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP03320 |
SMDDLDDPRLMTMSFG
|
16 | Caenorhabditis elegans | NA | NLP-7 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
| NP03321 |
AFDRFDNSGVFSFGA
|
15 | Caenorhabditis elegans | NA | NLP-8 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP03322 |
AFDRMDNSDFFGA
|
13 | Caenorhabditis elegans | NA | NLP-8 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP03323 |
FDRYDDETAYGYGFDNHIF
|
19 | Caenorhabditis elegans | NA | NLP-8 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
| NP03324 |
SFDRMGGTEFGLM
|
13 | Caenorhabditis elegans | NA | NLP-8 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP03325 |
DQAAALPYYLYE
|
12 | Caenorhabditis elegans | NA | NLP-9 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
| NP03326 |
GGGRAFAGSWSPYLERFYDY
|
20 | Caenorhabditis elegans | NA | NLP-9 | 17564681#Husson SJ, Janssen T, Baggerman G, Bogert B, Kahn-Kirby AH, Ashrafi K, Schoofs L#Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry#J Neurochem 2007 Jul;102(1):246-60 | |
| NP03327 |
GGGRAFNHNANLFRFD
|
16 | Caenorhabditis elegans | NA | NLP-9 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP03328 |
TPIAEAQGAPEDVDDRRELE
|
20 | Caenorhabditis elegans | NA | NLP-9 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 | |
| NP03521 |
SPAISPAYQFENAFGLSEALERA
|
23 | Caenorhabditis elegans | NA | Neuropeptide-like peptide 11 | 16061202#Husson S.J., Clynen E., Baggerman G., De Loof A., Schoofs L.; #Discovering neuropeptides in Caenorhabditis elegans by two dimensional liquid chromatography and mass spectrometry.; #Biochem. Biophys. Res. Commun. 335:76-86(2005). | |
| NP03604 |
SMVARQIPQTVVADH
|
15 | Caenorhabditis elegans | NA | Neuropeptide-like peptide 36 | 20013198#Husson SJ, Clynen E, Boonen K, Janssen T, Lindemans M, Baggerman G, Schoofs L#Approaches to identify endogenous peptides in the soil nematode Caenorhabditis elegans#Methods Mol Biol 2010;615:29-47 $16061202#Husson S.J., Clynen E., Baggerman G., De Loof A., Schoofs L.#Discovering neuropeptides in Caenorhabditis elegans by two dimensional liquid chromatography and mass spectrometry.#Biochem. Biophys. Res. Commun. 335:76-86(2005). | |
| NP03606 |
MIEITVNDRLGKKVRIKCNPSDTIGDLKKLIAAQTGTRWEKIVLKKWYTIYKDHITLMDYEIHEGFNFELYYQ
|
73 | Caenorhabditis elegans | NA | Ubiquitin-like protein 5 | ||
| NP05929 |
GMYGGW
|
6 | Caenorhabditis elegans | YGGW-amide related peptide | GMYGGW-amide (Potential) | ||
| NP05930 |
GMYGGY
|
6 | Caenorhabditis elegans | YGGW-amide related peptide | GMYGGY-amide (Potential) | ||
| NP05931 |
GYGGYGGY
|
8 | Caenorhabditis elegans | YGGW-amide related peptide | GYGGYGGY-amide (Potential) | ||
| NP05932 |
QWGYGGY
|
7 | Caenorhabditis elegans | YGGW-amide related peptide | QWGYGGY-amide (Potential) | ||
| NP05933 |
RGMW
|
4 | Caenorhabditis elegans | YGGW-amide related peptide | GMW-amide (Potential) | ||
| NP05934 |
GYGGY
|
5 | Caenorhabditis elegans | YGGW-amide related peptide | GYGGY-amide (Potential) | ||
| NP05935 |
PYGGYGW
|
7 | Caenorhabditis elegans | YGGW-amide related peptide | PYGGYGW-amide (Potential) | ||
| NP05936 |
GFYGG
|
5 | Caenorhabditis elegans | YGGW-amide related peptide | GFYGG-amide (Potential) | ||
| NP05937 |
GGG
|
3 | Caenorhabditis elegans | YGGW-amide related peptide | GGG-amide (Potential) | ||
| NP05938 |
GGGW
|
4 | Caenorhabditis elegans | YGGW-amide related peptide | GGGW-amide (Potential) | ||
| NP05939 |
GGGWG
|
5 | Caenorhabditis elegans | YGGW-amide related peptide | GGGWG-amide (Potential) | ||
| NP05940 |
GGW
|
3 | Caenorhabditis elegans | YGGW-amide related peptide | GGW-amide (Potential) | ||
| NP05941 |
GYG
|
3 | Caenorhabditis elegans | YGGW-amide related peptide | GYG-amide (Potential) | ||
| NP05942 |
YGGWG
|
5 | Caenorhabditis elegans | YGGW-amide related peptide | YGGWG-amide (Potential) |