Total number of results for Bombina orientalis are 4
Download
as Fasta All
| NPID | Sequence | Length | Organism | Family | Name | PMID | Peptide_REF |
|---|---|---|---|---|---|---|---|
| NP00778 |
SPTSQQHNDAASLSKIYPRGSHWAVGHLM
|
29 | Bombina orientalis | Bombesin/neuromedin-B/ranatensin | Gastrin-releasing peptide | ||
| NP00779 |
GSHWAVGHLM
|
10 | Bombina orientalis | Bombesin/neuromedin-B/ranatensin | Neuromedin-C | 1551901#Nagalla S.R., Gibson B.W., Tang D., Reeve J.R. Jr., Spindel E.R.#Gastrin-releasing peptide (GRP) is not mammalian bombesin. Identification and molecular cloning of a true amphibian GRP distinct from amphibian bombesin in Bombina orientalis.# J. Biol. Chem. 267:6916-6922(1992). | |
| NP00780 |
SIEEYPYAYDEADRSSAAVFSEGDKPSDGYQQWKESLLNLLKMIEVNEYRNSKAMREASVYN
|
62 | Bombina orientalis | Bombesin/neuromedin-B/ranatensin | C-terminal extension peptide (Potential) | ||
| NP03741 |
DSSGIVGRPFFLFRPRN
|
17 | Bombina orientalis | Neuromedins | Neuromedin-S-17 | 16682011#Chen T., Zhou M., Walker B., Harriot P., Mori K., Miyazato M.,Kangawa K., Shaw C.#Structural and functional analogs of the novel mammalian neuropeptide, neuromedin S (NmS), in the dermal venoms of Eurasian bombinid toads.#Biochem. Biophys. Res. Commun. 345:377-384(2006). |