| NPID | NP00780 |
| Name | C-terminal extension peptide (Potential) |
| Organism | Bombina orientalis |
| NCBI Taxa ID | 8346 |
| Tissue Specificity | Brain and stomach. In the stomach GRP was localized, at the base of the gastric pits, to occasional cells whose distribution and appearance were consistent with that of gut neuroendocrine cells. |
| Family | Bombesin/neuromedin-B/ranatensin |
| UniProt ID | GRP_BOMOR |
| Length | 62 |
| Modification | |
| Gene Ontology | |
| Sequence | SIEEYPYAYDEADRSSAAVFSEGDKPSDGYQQWKESLLNLLKMIEVNEYRNSKAMREASVYN |
| Properties | View |
| Structure | |
| Reference |