Total number of results for Sauvagine/corticotropin-releasing factor/urotensin I are 25
Download
as Fasta All
| NPID | Sequence | Length | Organism | Family | Name | PMID | Peptide_REF |
|---|---|---|---|---|---|---|---|
| NP05226 |
SEEPPMSDLTFHMLRNMHRAKMEGEREQALNRNLLDEV
|
38 | Hippoglossoides elassodon | Sauvagine/corticotropin-releasing factor/urotensin I | urotensin I | 19215432#McMaster D, Itoh H, Maccannell KL, Rivier J, Rivier C, Vale W, Fryer JN, Tran TN, Lederis K#Isolation, Amino-Acid Sequence, Synthesis and Biological Properties of Urotensin I from Hippoglossoides elassodon#J Neuroendocrinol 1990 Dec 1;2(6):875-82 | |
| NP05227 |
SEEPPISLDLTFHLLRELEMARAEQLAQQAHSNRKLMENF
|
40 | NA | Sauvagine/corticotropin-releasing factor/urotensin I | Corticotropin-releasing factor | 3010325#Patthy M, Schlesinger DH, Horvath J, Mason-Garcia M, Szoke B, Schally AV#Purification and characterization of peptides with corticotropin-releasing factor activity from porcine hypothalami#Proc Natl Acad Sci U S A 1986 May;83(9):2969-73 | |
| NP05228 |
PAETPNSLDLTFHLLREMIEIAKHENQQMQADSNRRIMDTI
|
41 | Scyliorhinus canicula | Sauvagine/corticotropin-releasing factor/urotensin I | Corticotropin-releasing hormone | 8536945#Waugh D, Anderson G, Armour KJ, Balment RJ, Hazon N, Conlon JM#A peptide from the caudal neurosecretory system of the dogfish Scyliorhinus canicula that is structurally related to urotensin I#Gen Comp Endocrinol 1995 Sep;99(3):333-9 | |
| NP05229 |
IGSLSVVNSVDVLRERVLLELARRKAMENQQQLGENQYVFKSV
|
43 | Nasonia vitripennis | Sauvagine/corticotropin-releasing factor/urotensin I | Diuretic hormone 44 | 20695486#Hauser F, Neupert S, Williamson M, Predel R, Tanaka Y, Grimmelikhuijzen CJ#Genomics and peptidomics of neuropeptides and protein hormones present in the parasitic wasp Nasonia vitripennis#J Proteome Res 2010 Oct 1;9(10):5296-310 | |
| NP05230 |
NDDPPISIDLTFHLLRNMIEMARIENEREQAGLNRKYLDEV
|
41 | Catostomus commersonii | Sauvagine/corticotropin-releasing factor/urotensin I | Urotensin I | 6981844#Lederis K, Letter A, McMaster D, Moore G, Schlesinger D#Complete amino acid sequence of urotensin I, a hypotensive and corticotropin-releasing neuropeptide from Catostomus#Science 1982 Oct 8;218(4568):162-5 $6313156#Lederis K., Letter A., McMaster D., Ichikawa T., McCannell K.L.,Rivier J., Rivier C., Vale W., Fryer J., Kobayashi Y.#Isolation, analysis of structure, synthesis, and biological actions of urotensin I neuropeptides.#Can. J. Biochem. Cell Biol. 61:602-614(1983). | |
| NP05231 |
SQEPPISLDLTFHLLREVLEMTKADQLAQQAHNNRKLLDIA
|
41 | Bos taurus | Sauvagine/corticotropin-releasing factor/urotensin I | Corticoliberin | ||
| NP05232 |
SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII
|
41 | Canis familiaris | Sauvagine/corticotropin-releasing factor/urotensin I | Corticoliberin | ||
| NP05233 |
SEEPPISLDLTFHLLREVLEMARAEQMAQQAHSNRKMMEIF
|
41 | Carassius auratus | Sauvagine/corticotropin-releasing factor/urotensin I | Corticoliberin | ||
| NP05234 |
SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKMMEIF
|
41 | Catostomus commersonii | Sauvagine/corticotropin-releasing factor/urotensin I | Corticoliberin-1 | ||
| NP05235 |
SEEPPISLDLTFHLLREVLEMARAEQLVQQAHSNRKMMEIF
|
41 | Catostomus commersonii | Sauvagine/corticotropin-releasing factor/urotensin I | Corticoliberin-2 | ||
| NP05236 |
SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII
|
41 | Mus musculus | Sauvagine/corticotropin-releasing factor/urotensin I | Corticoliberin | ||
| NP05237 |
SQEPPISLDLTFHLLREVLEMTKADQLAQQAHSNRKLLDIA
|
41 | Ovis aries | Sauvagine/corticotropin-releasing factor/urotensin I | Corticoliberin | 6273874#Spiess J., Rivier J., Rivier C., Vale W.#Primary structure of corticotropin-releasing factor from ovine hypothalamus.# Proc. Natl. Acad. Sci. U.S.A. 78:6517-6521(1981).$6267699#Vale W., Spiess J., Rivier C., Rivier J.#Characterization of a 41-residue ovine hypothalamic peptide that stimulates secretion of corticotropin and beta-endorphin.#Science 213:1394-1397(1981).$2647152#Audhya T., Hollander C.S., Schlesinger D.H., Hutchinson B.#Structural characterization and localization of corticotropin-releasing factor in testis.#Biochim. Biophys. Acta 995:10-16(1989). | |
| NP05238 |
SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII
|
41 | Sus scrofa | Sauvagine/corticotropin-releasing factor/urotensin I | Corticoliberin | 3878520#Patthy M., Horvath J., Mason-Garcia M., Szoke B., Schlesinger D.H., Schally A.V.#Isolation and amino acid sequence of corticotropin-releasing factor from pig hypothalami.# Proc. Natl. Acad. Sci. U.S.A. 82:8762-8766(1985). | |
| NP05239 |
AEEPPISLDLTFHLLREVLEMARAEQIAQQAHSNRKLMDII
|
41 | Xenopus laevis | Sauvagine/corticotropin-releasing factor/urotensin I | Corticoliberin | ||
| NP05240 |
VTLSLDVPTNIMNILFNIAKAKNLRAKAAANAHLMAQI
|
38 | Bos taurus | Sauvagine/corticotropin-releasing factor/urotensin I | Urocortin-3 | ||
| NP05241 |
SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII
|
41 | Homo sapiens | Sauvagine/corticotropin-releasing factor/urotensin I | Corticoliberin | ||
| NP05242 |
DNPSLSIDLTFHLLRTLLELARTQSQRERAEQNRIIFDSV
|
40 | Homo sapiens | Sauvagine/corticotropin-releasing factor/urotensin I | Urocortin | ||
| NP05243 |
IVLSLDVPIGLLQILLEQARARAAREQATTNARILARVGHC
|
41 | Homo sapiens | Sauvagine/corticotropin-releasing factor/urotensin I | Urocortin-2 | ||
| NP05244 |
FTLSLDVPTNIMNLLFNIAKAKNLRAQAAANAHLMAQI
|
38 | Homo sapiens | Sauvagine/corticotropin-releasing factor/urotensin I | Urocortin-3 | ||
| NP05245 |
DDPPLSIDLTFHLLRTLLELARTQSQRERAEQNRIIFDSV
|
40 | Mus musculus | Sauvagine/corticotropin-releasing factor/urotensin I | Urocortin | ||
| NP05246 |
VILSLDVPIGLLRILLEQARYKAARNQAATNAQILAHV
|
38 | Mus musculus | Sauvagine/corticotropin-releasing factor/urotensin I | Urocortin-2 | ||
| NP05247 |
FTLSLDVPTNIMNILFNIDKAKNLRAKAAANAQLMAQI
|
38 | Mus musculus | Sauvagine/corticotropin-releasing factor/urotensin I | Urocortin-3 | ||
| NP05248 |
SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII
|
41 | Rattus norvegicus | Sauvagine/corticotropin-releasing factor/urotensin I | Corticoliberin | 6603620# Rivier J., Spiess J., Vale W.; # "Characterization of rat hypothalamic corticotropin-releasing factor."; # Proc. Natl. Acad. Sci. U.S.A. 80:4851-4855(1983). | |
| NP05249 |
DDPPLSIDLTFHLLRTLLELARTQSQRERAEQNRIIFDSV
|
40 | Rattus norvegicus | Sauvagine/corticotropin-releasing factor/urotensin I | Urocortin | ||
| NP05250 |
VILSLDVPIGLLRILLEQARNKAARNQAATNAQILARV
|
38 | Rattus norvegicus | Sauvagine/corticotropin-releasing factor/urotensin I | Urocortin-2 |