| NPID | NP05247 |
| Name | Urocortin-3 |
| Organism | Mus musculus |
| NCBI Taxa ID | 10090 |
| Tissue Specificity | Expressed in some areas of the brain including the hypothalamus, amygdala, and brainstem, but is not evident in the cerebellum, pituitary, or cerebral cortex; it is also expressed peripherally in small intestine and skin. |
| Family | Sauvagine/corticotropin-releasing factor/urotensin I |
| UniProt ID | UCN3_MOUSE |
| Length | 38 |
| Modification | |
| Gene Ontology | |
| Sequence | FTLSLDVPTNIMNILFNIDKAKNLRAKAAANAQLMAQI |
| Properties | View |
| Structure | NA |
| Reference |
Neuropeptide