Browse page

Total number of results for Opisthacanthus madagascariensis are 5

BPID	Classification	Organism	Name	Length	Sequence
BP0406	Toxin and venom peptide	Opisthacanthus madagascariensis	Potassium channel toxin alpha-KTx 6.11	41	VHTNIPCRGTSDCYEPCEKKYNCARAKCMNRHCNCYNNCPW
BP0416	Toxin and venom peptide	Opisthacanthus madagascariensis	Potassium channel toxin kappa-KTx 2.3	23	NDPCEEVCLQHTGNVKACEEACQ
BP0734	Antimicrobial	Opisthacanthus madagascariensis	Cytotoxic linear peptide IsCT	13	ILGKIWEGIKSLF
BP0837	Toxin and venom peptide	Opisthacanthus madagascariensis	Potassium channel toxin kappa-KTx 2.1	26	DPCYEVCLQQHGNVKECEEACKHPVE
BP0838	Toxin and venom peptide	Opisthacanthus madagascariensis	Potassium channel toxin kappa-KTx 2.2	27	DPCYEVCLQQHGNVKECEEACKHPVEY