| NPID | NP05460 |
| Name | Prolactin-2C3 |
| Organism | Mus musculus |
| NCBI Taxa ID | 10090 |
| Tissue Specificity | Expressed in placenta and hair follicles, with highest expression levels detected in the outer root sheath and no expression detected in bulb (at protein level). Expressed in placenta, skin wounds, keratinocytes and weakly in embryonic fibroblasts. Expressed in brain, cerebellum and in Neuro-2a cell line (PubMed:16876275). Not detected in liver, kidney, ovary, pituitary gland and brain (PubMed:3859868). |
| Family | Somatotropin/prolactin |
| UniProt ID | PR2C3_MOUSE |
| Length | 195 |
| Modification | |
| Gene Ontology | |
| Sequence | FPMCAMRNGRCFMSFEDTFELAGSLSHNISIEVSELFNEFEKHYSNVSGLRDKSPMRCNTSFLPTPENKEQARLTHYAALLKSGAMILDAWESPLDDLVSELSTIKNVPDIIISKATDIKKKINAVRNGVNALMSTMLQNGDEEKKNPAWFLQSDNEDARIHSLYGMISCLDNDFKKVDIYLNVLKCYMLKIDNC |
| Properties | View |
| Structure | |
| Reference |
Neuropeptide